KEGG   Escherichia coli KO11FL: EKO11_0719Help
Entry
EKO11_0719        CDS       T01718                                 

Definition
cytochrome-c3 hydrogenase (EC:1.12.2.1)
Orthology
K06281  
hydrogenase large subunit [EC:1.12.99.6]
Organism
eko  Escherichia coli KO11FL
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:eko00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
746787..748490
Genome map
AA seq 567 aa AA seqDB search
MSQRITIDPVTRIEGHLRIDCEIENGVVSKAWASGTMWRGMEEIVKNRDPRDAWMIVQRI
CGVCTTTHALSSVRAAESALNIDVPVNAQYIRNIILAAHTTHDHIVHFYQLSALDWVDIT
SALQADPTKASEMLKGVSTWHLNSPEEFTKVQNKIKDLVASGQLGIFANGYWGHPAMKLP
PEVNLIAVAHYLQALECQRDANRVVALLGGKTPHIQNLAVGGVANPINLDGLGVLNLERL
MYIKSFIDKLSDFVEQVYKVDTAVIAAFYPEWLTRGKGAVNYLSVPEFPTDSKNGSFLFP
GGYIENADLSSYRPITSHSDEYLIKGIQESAKHSWYKDEAPQAPWEGTTIPAYDGWSDDG
KYSWVKSPTFYGKTVEVGPLANMLVKLAAGRESTQNKLNEIVAIYQKLTGNTLEVAQLHS
TLGRIIGRTVHCCELQDILQNQYSALITNIGKGDHTTFVKPNIPATGEFKGVGFLEAPRG
MLSHWMVIKDGIISNYQAVVPSTWNSGPRNFNDDVGPYEQSLVGTPVADPNKPLEVVRTI
HSFDPCMACAVHVVDADGNEVVSVKVL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagaattactattgatccggtaacccgtattgaggggcatttacgcatcgat
tgcgaaatcgaaaatggcgtcgtttcgaaagcatgggcttccggtaccatgtggcgcggc
atggaagagatcgtgaaaaaccgcgatccgcgcgatgcatggatgattgtgcaacgtatc
tgtggcgtatgtactaccactcacgcgctgtcttccgttcgtgcggcagaaagtgcgctg
aatatcgacgttccggttaacgcgcaatacatccgtaacatcattctggctgcgcacacc
acgcatgaccatatcgttcatttctatcagctttcggcgctggactgggtggacatcact
tctgcactgcaagctgacccaaccaaagcctccgaaatgctgaaaggcgtttcgacctgg
catctgaacagtccggaagagttcactaaagttcagaacaagatcaaagatctggttgcc
agcggtcagttgggtattttcgctaatggctactggggtcacccagcgatgaaactgccg
ccggaagtgaacctgattgcggtagcgcactacctgcaggcgctggagtgccagcgtgac
gctaaccgcgtcgtggcgctgctgggcggtaaaacgccgcacattcagaacctggcagtg
ggtggtgtcgcgaacccaatcaacctcgacgggttgggcgtgttgaaccttgagcgcctg
atgtacatcaagtctttcatcgacaaactgagcgactttgttgagcaggtttataaggtt
gataccgcggttatcgccgcgttctacccggaatggctgacgcgcggtaaaggtgcggtg
aactacctgagcgtgccggaattcccgaccgacagcaaaaacggcagcttcctgttcccg
ggcggctacattgagaatgcggatctgtcctcgtatcgtccgatcacttctcattccgat
gaatacctgatcaaaggcattcaggaaagcgcgaagcactcctggtataaagacgaagcg
ccacaggcgccgtgggaaggtaccaccattccggcttatgatggttggtctgacgacggg
aaatattcctgggtgaaatcaccgactttctacggcaaaacggtagaagtggggccgctg
gctaatatgctggtgaaactggcggcaggtcgagaatctacccagaacaaactgaatgaa
atcgttgcgatttatcagaaactgactggcaacacgctggaagtggcacagctgcactcc
acgctgggccgtattattggtcgtaccgttcactgctgtgaattgcaggatatcctgcaa
aaccaatacagtgcactgatcaccaatatcggcaaaggcgatcacaccacctttgtgaaa
ccgaacattccggcaacgggtgagttcaaaggtgttggcttcctcgaagcgccgcgcggt
atgctctctcactggatggtgatcaaagacggtatcatcagcaactaccaggcagttgtt
ccatcaacctggaactctggtccgcgtaacttcaatgatgacgtcggtccttacgagcag
tcgctggtgggtacaccggttgctgatccgaataaaccgctggaagtggtgcgtaccatt
cactccttcgacccgtgcatggcctgtgcggtacacgtagtggatgccgacggcaacgaa
gtggtttcagtgaaggttctgtaa

DBGET integrated database retrieval system