KEGG   Escherichia coli KO11FL: EKO11_0719Help
Entry
EKO11_0719        CDS       T01718                                 

Definition
cytochrome-c3 hydrogenase (EC:1.12.2.1)
Orthology
K06281  
hydrogenase large subunit [EC:1.12.99.6]
Organism
eko  Escherichia coli KO11FL
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    EKO11_0719
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With other acceptors
    1.12.99.6  hydrogenase (acceptor)
     EKO11_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
746787..748490
Genome map
AA seq 567 aa AA seqDB search
MSQRITIDPVTRIEGHLRIDCEIENGVVSKAWASGTMWRGMEEIVKNRDPRDAWMIVQRI
CGVCTTTHALSSVRAAESALNIDVPVNAQYIRNIILAAHTTHDHIVHFYQLSALDWVDIT
SALQADPTKASEMLKGVSTWHLNSPEEFTKVQNKIKDLVASGQLGIFANGYWGHPAMKLP
PEVNLIAVAHYLQALECQRDANRVVALLGGKTPHIQNLAVGGVANPINLDGLGVLNLERL
MYIKSFIDKLSDFVEQVYKVDTAVIAAFYPEWLTRGKGAVNYLSVPEFPTDSKNGSFLFP
GGYIENADLSSYRPITSHSDEYLIKGIQESAKHSWYKDEAPQAPWEGTTIPAYDGWSDDG
KYSWVKSPTFYGKTVEVGPLANMLVKLAAGRESTQNKLNEIVAIYQKLTGNTLEVAQLHS
TLGRIIGRTVHCCELQDILQNQYSALITNIGKGDHTTFVKPNIPATGEFKGVGFLEAPRG
MLSHWMVIKDGIISNYQAVVPSTWNSGPRNFNDDVGPYEQSLVGTPVADPNKPLEVVRTI
HSFDPCMACAVHVVDADGNEVVSVKVL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagaattactattgatccggtaacccgtattgaggggcatttacgcatcgat
tgcgaaatcgaaaatggcgtcgtttcgaaagcatgggcttccggtaccatgtggcgcggc
atggaagagatcgtgaaaaaccgcgatccgcgcgatgcatggatgattgtgcaacgtatc
tgtggcgtatgtactaccactcacgcgctgtcttccgttcgtgcggcagaaagtgcgctg
aatatcgacgttccggttaacgcgcaatacatccgtaacatcattctggctgcgcacacc
acgcatgaccatatcgttcatttctatcagctttcggcgctggactgggtggacatcact
tctgcactgcaagctgacccaaccaaagcctccgaaatgctgaaaggcgtttcgacctgg
catctgaacagtccggaagagttcactaaagttcagaacaagatcaaagatctggttgcc
agcggtcagttgggtattttcgctaatggctactggggtcacccagcgatgaaactgccg
ccggaagtgaacctgattgcggtagcgcactacctgcaggcgctggagtgccagcgtgac
gctaaccgcgtcgtggcgctgctgggcggtaaaacgccgcacattcagaacctggcagtg
ggtggtgtcgcgaacccaatcaacctcgacgggttgggcgtgttgaaccttgagcgcctg
atgtacatcaagtctttcatcgacaaactgagcgactttgttgagcaggtttataaggtt
gataccgcggttatcgccgcgttctacccggaatggctgacgcgcggtaaaggtgcggtg
aactacctgagcgtgccggaattcccgaccgacagcaaaaacggcagcttcctgttcccg
ggcggctacattgagaatgcggatctgtcctcgtatcgtccgatcacttctcattccgat
gaatacctgatcaaaggcattcaggaaagcgcgaagcactcctggtataaagacgaagcg
ccacaggcgccgtgggaaggtaccaccattccggcttatgatggttggtctgacgacggg
aaatattcctgggtgaaatcaccgactttctacggcaaaacggtagaagtggggccgctg
gctaatatgctggtgaaactggcggcaggtcgagaatctacccagaacaaactgaatgaa
atcgttgcgatttatcagaaactgactggcaacacgctggaagtggcacagctgcactcc
acgctgggccgtattattggtcgtaccgttcactgctgtgaattgcaggatatcctgcaa
aaccaatacagtgcactgatcaccaatatcggcaaaggcgatcacaccacctttgtgaaa
ccgaacattccggcaacgggtgagttcaaaggtgttggcttcctcgaagcgccgcgcggt
atgctctctcactggatggtgatcaaagacggtatcatcagcaactaccaggcagttgtt
ccatcaacctggaactctggtccgcgtaacttcaatgatgacgtcggtccttacgagcag
tcgctggtgggtacaccggttgctgatccgaataaaccgctggaagtggtgcgtaccatt
cactccttcgacccgtgcatggcctgtgcggtacacgtagtggatgccgacggcaacgaa
gtggtttcagtgaaggttctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system