KEGG   Escherichia coli KO11FL: EKO11_1330Help
Entry
EKO11_1330        CDS       T01718                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eko  Escherichia coli KO11FL
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EKO11_1330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EKO11_1330
   00052 Galactose metabolism
    EKO11_1330
   00500 Starch and sucrose metabolism
    EKO11_1330
   00520 Amino sugar and nucleotide sugar metabolism
    EKO11_1330
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EKO11_1330
   00524 Butirosin and neomycin biosynthesis
    EKO11_1330
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EKO11_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1411974..1412939
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HNNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtcgaaggtaaacctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggtcctgggctggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgtgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcattaacgctgggaacctttggtggggtttatatt
gctggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
cataacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system