KEGG   Escherichia coli KO11FL: EKO11_1755Help
Entry
EKO11_1755        CDS       T01718                                 

Definition
regulatory protein GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eko  Escherichia coli KO11FL
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EKO11_1755
   00052 Galactose metabolism
    EKO11_1755
   00500 Starch and sucrose metabolism
    EKO11_1755
   00520 Amino sugar and nucleotide sugar metabolism
    EKO11_1755
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EKO11_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1853815..1854708
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLELRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcatgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctcttcttgaactgcgc
gtgaagcgtcaactactggcggaagttcagtccatctgcccgccgggcgtgaccattatg
aacgtacgtcagggcgaacctttaggtttaggtcactccattttgtgtgcacgacccgcc
attggtgacaacccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagtgcc
gacccgctgcgctacaaccttgcagccatgattgcgcgcttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcattcagaccaaa
gaaccactggatcgtgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggattcagacatcatggccgttggtcgctatgtgctttctgcagat
atttggccggaacttgaacgcactcagcctggtgcatgggggcgtattcagctgactgat
gccatcgctgaactggcgaaaaaacagtctgttgatgccatgctgatgacaggtgacagc
tacgactgcggtaaaaaaatgggttatatgcaggcatttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaaggtattgagaagctgttaagcgaataa

DBGET integrated database retrieval system