KEGG   Escherichia coli KO11FL: EKO11_1855Help
Entry
EKO11_1855        CDS       T01718                                 

Definition
D-cysteine desulfhydrase family pyridoxal phosphate-dependent protein
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
eko  Escherichia coli KO11FL
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EKO11_1855
Enzymes [BR:eko01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     EKO11_1855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1957737..1958723
Genome map
AA seq 328 aa AA seqDB search
MPLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPNAQLEELATRVEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVNISSVVVASGSAGTHAGLAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAK
ELELTASAEILLWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIGGIS
QKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcataatttaacccgttttccacggttggagtttatcggcgcgccaacgccg
ctcgaatatctgccgcgcttttctgattatcttggacgggaaattttcatcaaacgggat
gacgtcacacccatggcaatgggcggcaataaattacgtaagctggaatttctcgcggca
gatgccctgcgcgaaggtgccgatacgctgattactgccggcgcgatccagtctaaccat
gtgcgccagactgccgcagtcgcggcgaaactcggtctgcactgcgtggcgctgctggaa
aatcctattggcacaaccgcagaaaactatttaaccaacggcaatcgtttgttgctggat
ctgttcaatacccagattgaaatgtgcgatgcactgaccgatcccaatgcccaactggaa
gagctggcgacgcgagtcgaagcacaaggctttcgcccgtatgtcattccggttggcggt
tctaatgctcttggcgcgctaggttatgtggagagtgcgctggaaatcgcgcaacagtgt
gaaggggcggttaatatttcgtcggtggtagtcgcatcgggcagtgccggaactcacgcc
ggactggctgttgggctggaacacctgatgcctgaaagcgaactgattggcgtgaccgtg
tcgcgttccgttgccgatcaattgccgaaagtggttaacctacaacaggcgattgcgaaa
gaactggagctgaccgcatcagcggaaattttactctgggatgactattttgcacctggc
tacggcgtgccgaacgacgaaggcatggaagcagtgaaattgctggcgcggctggaaggc
attctgcttgatcctgtgtataccggaaaagcgatggcggggctgattggcggtatcagt
cagaaacgcttcaaagatgaagggccgattctgtttattcataccggcggtgcgcctgcg
ctgttcgcctatcatccccacgtttag

DBGET integrated database retrieval system