KEGG   Escherichia coli KO11FL: EKO11_2014Help
Entry
EKO11_2014        CDS       T01718                                 

Definition
Glu/Leu/Phe/Val dehydrogenase
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
eko  Escherichia coli KO11FL
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:eko00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eko00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:eko00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2115982..2117325)
Genome map
AA seq 447 aa AA seqDB search
MDQTYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERV
IQFRVVWVDDRNQVQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMA
GMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGS
GNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEF
GLVYLEGQQPWSVPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQ
QAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEG
EQTNYVQGANIAGFVKVADAMLAQGVI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacatattctctggagtcattcctcaaccatgtccaaaagcgcgacccgaat
caaaccgagttcgcgcaagccgttcgtgaagtaatgaccacactctggccttttcttgaa
caaaatccaaaatatcgccagatgtcattactggagcgtctggttgaaccggagcgcgtg
atccagtttcgcgtggtatgggttgatgatcgcaatcaggtacaggtcaaccgtgcatgg
cgtgtgcagttcagctctgccatcggcccgtacaaaggcggtatgcgcttccatccgtca
gttaacctctccattctcaaattcctcggcttcgaacaaaccttcaaaaatgccctgact
accctgccgatgggcggtggtaaaggcggtagcgattttgacccgaaaggtaaaagcgaa
ggcgaagtgatgcgtttctgccaggcgctgatgaccgagctttatcgtcatctgggcgcg
gataccgacgttccggcaggtgatatcggcgttggtggtcgtgaagtcggctttatggcg
gggatgatgaaaaagctctccaacaataccgcctgcgtcttcaccggtaagggcctttca
tttggcggtagtcttattcgcccggaagctaccggctacggtctggtttatttcacagaa
gcaatgttaaaacgccacggtatgggttttgaagggatgcgcgtttccgtttctggctcc
ggcaacgtcgcccagtacgctatcgaaaaagcgatggaatttggtgctcgtgtgatcact
gcgtcagactccagcggcactgtagttgatgaaagcggattcacgaaagagaaactggca
cgtcttatcgaaatcaaagccagccgcgatggtcgagtggcagattacgccaaagaattt
ggtctggtctatctcgaaggccaacagccgtggtctgtaccggttgatatcgccctgcct
tgcgccacccagaacgaactggatgttgacgccgcgcatcagcttatcgccaatggcgtt
aaagccgtcgctgaaggggcaaatatgccgaccaccatcgaagcgactgaactgttccag
caggcaggcgtactgtttgcaccgggtaaagcggctaatgctggcggtgtagcaacgtcg
ggcctggaaatggcacaaaacgctgcgcgcctgggctggaaagccgagaaagttgacgca
cgtttgcatcacatcatgctggatatccaccatgcctgtgttgagcatggtggtgaaggt
gagcaaaccaactacgtgcagggcgcgaacattgccggttttgtgaaggttgccgatgcg
atgctggcgcagggtgtgatttaa

DBGET integrated database retrieval system