KEGG   Escherichia coli KO11FL: EKO11_2065Help
Entry
EKO11_2065        CDS       T01718                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eko  Escherichia coli KO11FL
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eko00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:eko00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2165386..2165937
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatatcgacggtgaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggccgatcgaggttttgtggtg
ctgggattcccgtgcaaccagtttctggaacaagaaccgggcagcgatgaagagattaaa
acttactgtaccaccacatggggggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgccatccgctgtatcaaaaattgattgccgcagcgccgaccgcagtcgcg
ccggaagagagcggattctatgcccgtatggtcagcaaaggtcgtgcaccgctgtaccct
gatgatattttatggaattttgagaaatttttagttggcagggacggattggtcatccag
cgtttttccccggatatgacgccggaagaccccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system