KEGG   Escherichia coli KO11FL: EKO11_2342Help
Entry
EKO11_2342        CDS       T01718                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eko  Escherichia coli KO11FL
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EKO11_2342
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EKO11_2342
  Lipid metabolism
   00071 Fatty acid degradation
    EKO11_2342
  Amino acid metabolism
   00350 Tyrosine metabolism
    EKO11_2342
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EKO11_2342
   00626 Naphthalene degradation
    EKO11_2342
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EKO11_2342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2443099..2444109
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcacgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaactggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggcccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaatagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgctctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagttgctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgccttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgttaa

DBGET integrated database retrieval system