KEGG   Escherichia coli KO11FL: EKO11_2591Help
Entry
EKO11_2591        CDS       T01718                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eko  Escherichia coli KO11FL
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eko01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:eko00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:eko00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2698397..2699203
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPIEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKVFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcattgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggtatccccttctccgacccactggcggat
ggcccgaccattcaaaacgccactctgcgcgcctttgcggcaggtgtgactccggcacaa
tgttttgaaatgctggcactgattcgccagaaacacccgaccattcccattggcctgttg
atgtatgccaatctggtgtttaacaaaggcattgatgagttttatgcccagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgccaattgaagagtccgcgcccttccgc
caggccgcgttgcgccataatgtcgcacctatcttcatctgcccgccaaatgccgatgac
gacctgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcacgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcacctccattgcaggggtttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccattgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagtttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system