KEGG   Escherichia coli KO11FL: EKO11_3014Help
Entry
EKO11_3014        CDS       T01718                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eko  Escherichia coli KO11FL
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3135366..3135878)
Genome map
AA seq 170 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERSLERCVKQQPPQKVYDAVVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccgggttttcagcagcttcacacctccgtggaggggctgaaactgattgccgattac
gaaggttgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgacggcattggt
aatacatctggcgtcattccaggcaaaaccattacggaacgacaggcagcggaaggactg
atctccaacgtgctgcgtgtggagcggtcactggaaaggtgtgtgaagcaacagccaccg
cagaaggtgtatgacgcggtggtgtcatttgccttcaacgtgggaacgggcaatgcctgc
agctccacgctggtgaaattgctcaatcagcggcgctgggcggatgcgtgccgacagttg
ccgcgctgggtttatgtaaaaggtgtgtttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgtttacagggagcaaactga

DBGET integrated database retrieval system