KEGG   Escherichia coli KO11FL: EKO11_3203Help
Entry
EKO11_3203        CDS       T01718                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eko  Escherichia coli KO11FL
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eko00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3341107..3342771
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKSLVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcggaagaaa
gccctcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccattctcgctcacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaacccacgtactggcggtaaacggtgaaatctacaac
caccaggcattgcgcgctgaatatggcgatcgttatcagttccagacagggtctgactgt
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcctacctgattggtcgcgaccat
ctggggatcatcccactgtatatggggtatgacgaacacggtcagctgtatgtggcctca
gaaatgaaatcgctggtgccagtttgccgcacgattaaagagttcccggcggggagctat
ttgtggagccaggacggtgaaatccgttcttattatcatcgcgactggttcgactttgat
gcagtgaaagataacgtgaccgacaaaaacgagctgcgtcaggctctggaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctgctttctggtggtctggattcc
tcaattatttccgctatcaccaagaaatacgcagcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccccagttacactcctttgctgtaggtctgccgggttcaccggat
cttaaagcagcccaggaagtggcaaaccatctgggcacggtgcatcacgaaattcacttc
actgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacttatgat
gtgaccactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcgatg
ggcattaaaatggtgctgtccggtgaaggttctgatgaagtgtttggcggttatctttac
ttccataaagcgcccaacgctaaagaactgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgcgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccgcaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgagtcatac
ctgcccgcaagcgtggcctggcggcagaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcggcgcagcaggtttctgatcagcaactggaaact
gcccgcttccgcttcccgtacaacacgccaacctcaaaagaagcgtatctgtaccgggag
atctttgaagaactgttcccgcttccgagcgccgctgagtgcgtgcctggcggtccttcc
gtcgcgtgttcttccgctaaagcgattgagtgggatgaggcgttcaagaaaatggacgat
ccgtctggtcgtgcggttggcgttcaccagtcggcgtataagtaa

DBGET integrated database retrieval system