KEGG   Escherichia coli KO11FL: EKO11_3228Help
Entry
EKO11_3228        CDS       T01718                                 

Definition
alpha-ribazole phosphatase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
eko  Escherichia coli KO11FL
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EKO11_3228
Enzymes [BR:eko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     EKO11_3228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3371190..3371801
Genome map
AA seq 203 aa AA seqDB search
MRLWLIRHGETQANVDGLYSGHAPTPLTARGIEQAQNLHTLLHGVSFDLVLCSELERAQH
TARLVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEG
FQAFSQRVERFIARLSEFQHYQNILVVSHQGVLSLLIARLIGMPAEAMWHFRVDQGCWST
IDINQKFATLRVLNSRAIGVENA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtggttaattcgtcatggcgaaacgcaagcgaatgtcgatggtctgtacagc
ggtcatgcgcccacacccctgaccgcacgcggtattgagcaagcgcaaaatctgcatacg
ctgctacatggtgtttcctttgatctggttttatgcagtgaactggaacgggcacagcat
accgcgcgactggttctcagtgaccgccagctccccgtgcaaatcatccctgaactcaac
gaaatgttttttggcgactgggagatgcgacatcatcgcgacctcatgcaagaagatgcc
gaaaactatagcgcgtggtgcaatgactggcagcatgcaatccccacgaacggtgaagga
tttcaggcattttcgcaacgtgtggaacgctttatcgcaaggcttagtgaatttcagcac
tatcagaatattttagtcgtcagccatcagggtgtactgagtctgttaatcgcccgttta
attggcatgcctgccgaggctatgtggcattttcgcgttgaccaggggtgttggagcacc
attgatatcaaccaaaaattcgcgacgctacgcgtcctcaatagccgtgccatcggggtc
gagaatgcatga

DBGET integrated database retrieval system