KEGG   Escherichia coli KO11FL: EKO11_3352Help
Entry
EKO11_3352        CDS       T01718                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eko  Escherichia coli KO11FL
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EKO11_3352
Enzymes [BR:eko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EKO11_3352
   3.1.2  Thioester hydrolases
    3.1.2.-  
     EKO11_3352
Lipid biosynthesis proteins [BR:eko01004]
 Fatty acid synthase
  Component type
   EKO11_3352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3514094..3514720
Genome map
AA seq 208 aa AA seqDB search
MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSK
TSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQD
VKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaacaatgttttccgctggcatttgcccttcctgttcctggtcctgtta
accttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccggg
tatcgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaa
acgtcggtagttaatgccagcatcagcggcgacacctcgcaacaaggactggcgcgcctt
ccggctctgctgaaacagcatcagccgcgttgggtgctggttgaactgggcggcaatgac
ggtttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggat
gtcaaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggt
cgccgttataatgaagcctttagcgccatttaccccaaactcgccaaagagtttgatgtt
ccgctgctgcccttttttatggaagaggtctacctcaagccacaatggatgcaggatgac
ggtattcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttg
cagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system