KEGG   Escherichia coli KO11FL: EKO11_3561Help
Entry
EKO11_3561        CDS       T01718                                 

Definition
aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
Orthology
K11177  
xanthine dehydrogenase YagR molybdenum-binding subunit [EC:1.17.1.4]
Organism
eko  Escherichia coli KO11FL
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EKO11_3561
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     EKO11_3561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3742943..3745141
Genome map
AA seq 732 aa AA seqDB search
MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEEAPNAAYGYIVGSAIAK
GRLTALDTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPTIEHYHQAIALVVAETF
EQARAAASLVQAHYRRNKGAYSLADEKQAVNQPPEDTPDKNVGDFDGAFTSAAVKIDATY
TTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAKTLKVPVENVRIISPYIGG
GFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTHRPATLQHLRIGADQSGKIT
AISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLATLDLPEGNAMRAPGEAPGLMA
LEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRCFSRRQLIECLRTGADKFGWKQRNAT
PGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEQNGTVTVETDMTDIGTGSYTILAQTA
AEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTSGVYAACMKLREMIASAVGFDPEQ
SQFADGKITNGTRSATLHEATAGGRLTAEESIEFGTLSKEYQQSTFAGHFVEVGVHSATG
EVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMGAALMEELAVDDRLGYFVNHDMAGYE
VPVHADIPKQEVIFLDDTDPISSPMKAKGVGELGLCGVSAAIANAVYNATGIRVRDYPIT
LDKLLDKLPDVV
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgataaacccgcaggggaaaacccgatcgatcagctgaaggttgtcggtcgt
ccccatgaccgcatcgacggaccgctgaaaactaccggcacggcacgctacgcctacgaa
tggcatgaagaggcccccaacgccgcctatggctatatcgtcggttccgccattgccaaa
ggacgcctcaccgcccttgatacggacgccgcgcaaaaagcgccgggcgtactggctgtc
attaccgccagtaacgccggggcactcggcaaaggcgacaaaaacaccgccaggctgtta
ggcggccccactattgagcactatcatcaggccattgcgctggtagtggccgagaccttc
gaacaggcgcgagcggcggcctcgctggtgcaggcacactatcgccgtaataaaggagct
tactccctggcggacgaaaaacaggccgtcaatcagccgccggaagacacgcccgacaaa
aacgtcggtgactttgacggggctttcacctccgctgcggtgaagattgatgctacctac
acgaccccggaccagagccatatggcgatggagccgcatgcctcgatggccgtctgggat
ggaaataagcttaccctctggacctcaaatcagatgattgactggtgccgcaccgatctg
gcaaaaacgctgaaagttcccgtggagaatgtgcgtattatctccccgtatatcggcgga
gggtttggcggcaagctgttcctgagaagcgatgcgctgctggcggccctcgccgcccga
gcggtgaaacgtccggttaaagtgatgctcccccgcccctctattcccaataacaccacg
caccgccccgccacccttcagcacttgcgtatcggtgccgaccagagcgggaaaatcacc
gctatctcacatgaaagctggtctggaaacctgcccggcggcacgccggaaacggcggta
cagcaaagcgaattactctacgccggggcgaatcgtcataccggcctgcggctcgccacg
cttgatttgccggaagggaacgccatgcgtgcgcccggcgaagcccccggtctgatggcg
ctcgaaatcgcgatcgacgaactggcggaaaaagcgggcatcgatcccgtcgagtttcgc
atcctgaatgacactcaggttgaccccgccgacccgacgcgctgcttctctcgccgtcag
cttatcgagtgcttgcgcaccggagcggataaatttggctggaagcagcgcaacgccaca
cccggacaggtgcgcgacggggagtggctagtcggccacggtgttgcggcgggctttcgc
aataatctgctggaaaaatcgggtgctcgggttcacctcgaacaaaacggcaccgttacc
gtagaaacggacatgaccgacattggcaccggcagctacaccattctggcccagacggca
gcggaaatgcttggcgtaccgctggagcaggttgcggttcacctcggcgattccagtttc
ccggtttctgcgggttctggtggacaatggggcgcgaatacctccacctccggcgtttac
gccgcctgtatgaagcttcgcgaaatgattgcctcggcagtcgggtttgatcctgagcag
tcgcagtttgccgacggcaagattaccaacggtacccgaagcgccacgctacatgaagcc
accgcaggcggcagactgacagcggaagagagcattgaattcggaacactgagcaaagag
taccagcagtcgacctttgccgggcattttgtggaggtcggcgtgcatagcgcgacggga
gaagttcgggtccggcgtatgctcgctgtgtgtgctgcaggacgcatcctgaatccgaaa
actgcgcgcagccaggtcattggcgcaatgactatgggtatgggcgcggcactgatggag
gagctggcggtggatgaccgtttgggctacttcgttaatcacgatatggcggggtatgag
gtgccggtccatgcggatatcccaaaacaggaggtgattttcctggatgataccgacccc
atatcctccccgatgaaggccaaaggtgtcggtgagctgggcctgtgcggcgtgagcgcg
gctatcgccaacgcggtgtataacgccaccggtattcgggtacgggattatcccatcact
ctggataagctgctcgataagctgccggatgtggtttaa

DBGET integrated database retrieval system