KEGG   Escherichia coli KO11FL: EKO11_3623Help
Entry
EKO11_3623        CDS       T01718                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eko  Escherichia coli KO11FL
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3792867..3793382
Genome map
AA seq 171 aa AA seqDB search
MAGIPKKLKAALLAVTIAGGGVGGYQEMTRQSLIHLENIAYMPYRDIAGVLTVCVGHTGP
DIEMRRYSHAECMALLDSDLKPVYAAIDRLVRVPLTPYQKTALATFIFNTGVTAFSKSTL
LKKLNAGDYAGARDQMARWVFAAGHKWKGLMNRREVEMAIWNIRGADDLRQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcggggataccaaaaaaactgaaagccgcactgctggctgtaacgattgccggtggc
ggagtgggtggttatcaggaaatgacccgtcagtctctgatccacctggaaaatatcgct
tatatgccttaccgcgatattgccggtgtgcttacggtctgtgtgggacataccgggccg
gatatcgaaatgcgccgttacagccatgcggagtgtatggctctcctcgacagtgattta
aaaccggtttatgcggcaatcgatcgtcttgtcagggtgccgctgacgccatatcagaaa
acggcgctggcaacgtttattttcaacaccggtgttaccgcattcagtaaatcaacgctg
ctgaaaaaactcaatgccggtgattacgccggagcgcgtgaccagatggcccgctgggtg
tttgccgcaggccataaatggaaaggactgatgaaccgtcgcgaagtggaaatggcaatc
tggaatatcaggggggcggatgaccttcgccagtaa

DBGET integrated database retrieval system