KEGG   Escherichia coli KO11FL: EKO11_4054Help
Entry
EKO11_4054        CDS       T01718                                 

Definition
DNA-directed DNA polymerase (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eko  Escherichia coli KO11FL
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eko00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eko00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:eko03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eko03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eko03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4270540..4270983
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcgacgttctaccttctggacaatgacaccaccgtcgatggcttaagcgcc
gttgagcaactggtgtgtgaaattgccgcagaacgttggcgcagtggtaagcgcgtactc
atcgcctgtgaagatgaaaagcaggcttaccggctggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaaacgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system