KEGG   Escherichia coli KO11FL: EKO11_4389Help
Entry
EKO11_4389        CDS       T01718                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eko  Escherichia coli KO11FL
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eko00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4650846..4652354
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSST
LVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDG
LEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYAGWKKAVKRAMAWEEHDE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggcaccaccagctcccgcgcggtc
gtaatggatcacgatgccaatatcattagcgtgtcgcagcgcgaatttgagcaaatctac
ccaaaaccaggttgggtagaacacgacccaatggaaatctgggccacccaaagctccacg
ctggtagaagtgctggcgaaagccgatatcagttccgatcaaattgcagctatcggtatt
acgaaccagcgtgaaaccactattgtctgggaaaaagaaaccggcaagcctatctataac
gccattgtctggcagtgccgtcgtaccgcagaaatctgcgagcatttaaaacgtgacggt
ttagaagattatatccgcagcaataccggtctggtgattgacccgtacttttctggcacc
aaagtgaagtggatcctcgaccatgtggaaggctctcgcgagcgtgcacgtcgtggtgaa
ttgctgtttggtacggttgatacgtggcttatctggaaaatgactcagggccgtgtccat
gtgaccgattacaccaacgcctctcgtaccatgttgttcaacatccataccctggactgg
gacgacaaaatgctggaagtgctggatattccgcgcgagatgctgccagaagtgcgtcgt
tcttccgaagtatacggtcagactaacattggcggcaaaggcggcacgcgtattccaatc
tccgggatcgccggtgaccagcaggccgcgctgtttggtcagttgtgcgtgaaagaaggg
atggcgaagaacacctatggcactggctgctttatgctgatgaacactggcgagaaagcg
gtgaaatcagaaaacggcctgctgaccaccatcgcctgcggcccgactggcgaagtgaac
tatgcgttggaaggtgcggtgtttatggcaggcgcatccattcagtggctgcgcgatgag
atgaagttgattaacgacgcctacgattccgaatatttcgccaccaaagtgcaaaacacc
aatggtgtgtatgtggttccggcatttaccgggctgggtgcgccgtactgggacccgtat
gcgcgcggggcgattttcggtctgactcgtggggtgaacgctaaccacattatacgcgcg
acgctggagtctattgcttatcagacgcgtgacgtgctggaagcgatgcaggccgactct
ggtatccgtctgcacgccctgcgcgtggatggtggcgcagtagcaaacaatttcctgatg
cagttccagtccgatattctcggcacccgcgttgagcgcccggaagttcgcgaagtgact
gcattgggtgcggcctatcttgctggtctggcggtcggtttctggcagaacctcgacgag
ctgcaagagaaagcggtgattgaacgcgagttccgtccaggcatcgaaaccactgagcgt
aattaccgttacgcaggctggaaaaaagcggtcaaacgcgcgatggcgtgggaagaacac
gacgagtaa

DBGET integrated database retrieval system