KEGG   Escherichia coli KO11FL: EKO11_4396Help
Entry
EKO11_4396        CDS       T01718                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00010  Glycolysis / Gluconeogenesis
eko00051  Fructose and mannose metabolism
eko00562  Inositol phosphate metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01120  Microbial metabolism in diverse environments
eko01130  Biosynthesis of antibiotics
eko01200  Carbon metabolism
eko01230  Biosynthesis of amino acids
Module
eko_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eko_M00002  Glycolysis, core module involving three-carbon compounds
eko_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EKO11_4396
   00051 Fructose and mannose metabolism
    EKO11_4396
   00562 Inositol phosphate metabolism
    EKO11_4396
Enzymes [BR:eko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EKO11_4396
Exosome [BR:eko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EKO11_4396
  Exosomal proteins of bladder cancer cells
   EKO11_4396
  Exosomal proteins of melanoma cells
   EKO11_4396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADX52952
Structure
PDB: 

Jmol
Position
4656561..4657328
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacttctgcc
gctatgctgaaagacatcggcgctcagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system