KEGG   Eutypa lata: UCREL1_10621Help
Entry
UCREL1_10621      CDS       T03103                                 

Definition
putative steroid 5 alpha-reductase protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
ela  Eutypa lata
Brite
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     UCREL1_10621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 285 aa AA seqDB search
MAIVQDWLPASRGNYDTLVFWWQFYPLMGSLQWLVSWYGMGKTSVKSKFNIPGRIAWFTM
EVPGFMTLLYYMKTLPLEHGITDLPWQNKVLASLFVIHYTYRAVIFPFIQPSMSPIHFLV
WSNAIMFQVCNGSAIGGWLAAYGPTTSEEWQAQSSTLQFAVGLVLFYVGLTGNYFSDEEL
REIRRNEQRRQEKLKQKGHTNIEKHYEVPNNGLFRHMLYPHYFMEWVEWLGFWVAAGVSC
TPARCFLLNEVFAMFPRAVSGGKWYKEKFGEEKVKGKYVIIPGIY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttcaggattggcttcccgccagccgtggaaattatgacacgctagtcttc
tggtggcagttctaccccctcatgggatcccttcaatggctggtctcatggtatggcatg
ggaaagacttcggttaaaagcaaattcaacatcccaggcagaattgcctggttcaccatg
gaggttccgggtttcatgaccctcctttactacatgaagaccttgccacttgagcatggc
atcacagatcttccgtggcagaacaaggttttagctagtctcttcgtcattcactatacc
taccgtgctgtcatcttccccttcatccagccgtccatgtcgcccatccatttcctggta
tggagcaacgccatcatgttccaagtctgcaacggaagcgcaatcggcggctggctggca
gcatatggcccgacgacgtcggaggagtggcaggcgcagtcgtcgacgctgcagttcgcc
gtcggcctggtcctgttctacgtcgggctcaccgggaactacttctccgacgaggagctg
cgggagatccgcaggaacgagcagcgccggcaggagaagctaaagcagaagggtcacacc
aacatcgagaagcactacgaagtccccaacaacggcctgttcagacacatgctctacccg
cactacttcatggagtgggtcgagtggctcgggttctgggttgccgcgggcgtctcctgc
acccccgcgaggtgcttccttctcaatgaggtcttcgccatgttccctcgcgccgtctcg
ggtggcaagtggtacaaggagaagtttggcgaggagaaggtcaaggggaagtacgtcatt
atcccgggcatctactga

DBGET integrated database retrieval system