KEGG   Eutypa lata: UCREL1_1339Help
Entry
UCREL1_1339       CDS       T03103                                 

Definition
putative alkaline phosphatase protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ela  Eutypa lata
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UCREL1_1339
Enzymes [BR:ela01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     UCREL1_1339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 614 aa AA seqDB search
MIVMRYSSTPLPSLGISIRKVAARHYANSPWDPRELNFTHGVASGDPYEDSVILWTRAAP
IGSDNDRSNVTVSGYVPLYDHETEKYVQASTAPVCLEWKISETDDMGEVINSGNAYTSSD
IDYTVKVEAKNLKSFTTYWYQFNVCNSDVKLVVGRTKTIPAKGSKDVSNIKLAVFSCANY
PFGFFNAYGNVVNKDSVDYIVHLGDYIYEYKNGYYGWGDEFGRIPLPDREIVTLYDYRKR
LATYRTDESLYRNHQYFPWIPTWDDHEVGDNVYKDGMAELNNTEDSFIKDGGVSTDQRKM
NAVRAYFEWMPIRQVDMDDNLRIWRDFQFGDLFDLLMLDTRVYDRSITDMYWNTAYIDAI
RDDASRSLMGPRQETWFYRKLRESSRRRTAWRIVGSQVLFSRVNGSEDATGFLPTDGWDA
YQANRNRTLQTLYGDVEDDGVYGVIGNNVFLAGDVHSSYVSDLVWLDARPYDPMTGVGAI
GVEFGGTAITSPGGVNGNNGSVTEGNEQAAFLQGNNRELQWQDSFFRGYFELSVGYDAVN
ASFFGTPVISSPNGWEIPLANLTVMSGENRLHRGGGGGKVANGRVESGSVKGGETVGTNI
TLDTTTGEWFVLKW
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcatgcgttatagctcaactccactgcccagcctggggatatcgatccgcaaa
gttgctgcccgccactatgccaattcaccttgggatcccagggagctgaactttacgcac
ggagtagcttcgggggatccgtacgaagacagcgtcatactatggacgagggcggcgccc
atcggcagtgacaacgacaggagcaacgtcacggtatcaggatacgtgcctctgtacgac
catgagactgagaaatatgtccaggctagtactgctcctgtctgtctagaatggaagata
tccgagacggatgatatgggagaagtgatcaactctggcaatgcctacacgagctcggac
attgactatactgtgaaagtcgaagcaaagaaccttaagtccttcaccacatattggtac
caattcaatgtctgtaactcggatgtcaagttggtggtaggcagaaccaaaaccatcccg
gcaaaaggaagcaaagacgtctccaatatcaagcttgcagtattttcttgtgccaactat
ccgttcggattcttcaatgcatatggcaatgtcgtgaacaaagactccgtcgactatatc
gttcaccttggagactacatctatgagtacaagaatggttactacggttggggggatgag
ttcggccgcataccactgccggaccgtgaaattgtcacgttgtacgattaccgcaagcgc
ctagcgacatatagaactgatgagagcctataccgaaaccatcagtactttccctggatc
ccgacttgggatgatcatgaagtcggcgataacgtctacaaggacggaatggcggaactg
aacaacactgaagattctttcatcaaggatgggggcgtatcgactgaccaacgaaagatg
aacgcagttcgagcttactttgaatggatgccgatccgccaagtcgatatggacgacaac
cttcgcatttggcgggacttccagttcggggatctcttcgacctcctgatgctcgacacg
cgggtctacgaccggtctatcacggatatgtactggaacacggcgtacatcgatgctatc
cgagatgatgcgagccggtccctgatggggccgcgccaggagacctggttctaccgaaag
ctgcgggagagcagccggcgccggactgcgtggcgcatcgtcgggagccaggtgctgttc
agccgcgtgaacggcagcgaagatgcgacggggttcctacccaccgatggctgggacgcg
taccaggcgaaccgaaaccgtacgctacagactctgtacggcgacgttgaggatgacggg
gtctacggtgttataggcaacaacgtgttcctagcgggcgatgtacactcgtcgtacgtc
tcggacttagtgtggctagacgcgcgcccctatgacccgatgacgggggtgggcgcgatt
ggcgtcgagttcgggggcacggcgatcacgagcccgggtggcgtgaacgggaacaacggg
agcgtaaccgaaggcaacgaacaggcggcattcctgcagggcaacaaccgcgagctgcag
tggcaggacagcttcttccgggggtacttcgagctgtcggtcggttacgacgctgtcaac
gcgagcttcttcggcacgccggtcattagctcgccgaacggctgggagatcccccttgcg
aatctcaccgtcatgagcggcgagaacaggttgcatagaggtgggggcgggggcaaggtc
gcaaatggcagggttgagagtggaagcgtcaagggaggggagactgtggggacgaacatt
acgctggataccacgacgggagaatggtttgtcttgaaatggtga

DBGET integrated database retrieval system