KEGG   Eutypa lata: UCREL1_1492Help
Entry
UCREL1_1492       CDS       T03103                                 

Definition
(GenBank) putative extracellular invertase protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ela  Eutypa lata
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    UCREL1_1492
   00500 Starch and sucrose metabolism
    UCREL1_1492
Enzymes [BR:ela01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     UCREL1_1492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 587 aa AA seqDB search
MKLPSSVAATAGSLVARQAIDYNAAPPNLSTLANSSLFETWRPKAHVLPPTGQIGDPCMH
YTDPETGLFHVGWLHLGAAGATTDDLVTYSDVNPDGAPFIVAGGTNDPIAVFDGSVIPSG
VDGKPTLLYTSVSYLPIQWTIAYTRGSETQSLAISSDGGRNFTKVEHGPVIPSPPFAVNV
TGFRDPFVFQNGKLDDLLGSAEGTWYTVISGGVQGEGPSQFLYRQHDPDFQYWEELGQWW
HEEANSTWGGEGTWAGRWGFNFEVANVFSLDEHGYNGNGEVFTTLGAEWSLDPIVPEVSD
FREMLWAAGNVSLNEDGTPKFVPTMAGYIDSGHSAYAAAGKELPASSQASQKSGAPDRFI
SYVWLTGDFYGTLDFPTNQQNWTGALLLPRELSVGTIHGVVDNELVSETGSWRVASRCSG
VAELTTLKQVIAREALAALTTGDSYTEPDRTVDAPGVVAFQQTPESKFHVITASLSFAKG
SRGSDLQAGFQILSSEHESTTIYYQFSNESIIIDRTNTSAAAQTTNGIDSRNEAGRLRLF
DVQRDGKEQIETLELTIVVDNSVVEVHANGRFALSTWARYVVPPKLH
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcccatcctcggttgccgctacagccgggtccctagtggcccggcaagcaatc
gactacaacgccgcgccgccgaacctgtcgaccctcgccaactcgagcctcttcgagacc
tggcgtcccaaggcgcatgtacttccaccgacgggacagatcggggacccgtgcatgcac
tacacggacccggagacgggcctcttccacgtcggttggttgcacttgggcgcggcgggc
gccacaaccgatgacctcgtcacgtacagcgacgtgaacccggacggcgcgccgttcatc
gtcgccggtggcaccaacgaccccattgccgtgttcgacggttccgtgataccgagcggc
gtcgacggcaagcccacgttgctctatactagcgtttcgtacctgcccatccagtggacc
atcgcgtacacgcggggcagcgagacgcaatccctcgctatctcgagcgacggcgggcgc
aatttcacgaaggtagagcatgggcccgtgatcccgtcgcctcctttcgctgtcaacgtg
acagggttccgcgacccgttcgtattccagaacggcaagctcgacgaccttcttggaagc
gccgagggcacctggtacaccgtcatttcgggcggcgtgcagggtgagggacccagccag
ttcctctaccgacagcacgacccggacttccagtactgggaggagttgggtcagtggtgg
catgaggaggccaattcgacctggggcggcgaaggaacttgggccggtcgctggggcttc
aacttcgaggtagccaatgtgttcagcctcgacgaacatggctacaacggcaacggcgag
gtattcaccacgctcggcgccgagtggtcgctggaccccattgtgcccgaggtttctgac
ttccgtgagatgctctgggcggccggcaacgtctcgctcaacgaggacggcacgccaaag
ttcgtgcccaccatggcgggttatatcgactcgggccattccgcctacgcggccgctggc
aaggagctgcccgcttcctctcaggcgtcgcagaagagcggtgctccggatcgtttcatc
tcgtacgtctggcttacgggcgacttctacggcacgcttgacttcccgacgaaccagcag
aactggactggtgctctcctgctcccgcgagagctgagcgttggcacgatccatggagtc
gtcgataacgaactagttagcgagactggttcctggcgcgtggctagccgttgctcaggg
gtcgccgagttgacgaccctaaagcaggtgatcgcgcgggaggcgctcgccgcactaacc
accggggactcttacaccgagccagaccgcacggtcgatgcgccgggcgtagtagcattc
cagcagacaccggagagcaaattccacgtcatcacggcgtctctgtcgttcgcgaaggga
agccgcggtagtgacctacaggctggtttccagatcttatcttccgagcacgagagcacc
acgatctattaccagttctccaacgagtctatcatcatcgatcgcacgaacacgagcgcc
gcagcgcagaccacaaacggcatcgatagccgcaacgaagcgggccgactccgcctcttc
gatgtgcagcgagatggcaaggagcagatcgagaccctcgagttgactatcgttgtcgat
aactctgtcgtcgaggtccacgccaacggacgattcgctctgagcacatgggctcggtac
gttgttcctcctaaattgcattaa

DBGET integrated database retrieval system