KEGG   Eutypa lata: UCREL1_3957Help
Entry
UCREL1_3957       CDS       T03103                                 

Definition
putative beta- -glucanase protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ela  Eutypa lata
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    UCREL1_3957
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    UCREL1_3957
Enzymes [BR:ela01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     UCREL1_3957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 482 aa AA seqDB search
MLLTTTLSLLAGHAFATAVRPSVRTRQASAQAFATNQDLTYKLTSVDAPVVGPGSGGDSP
WNLTIDDTEAGHKQTVAGFGGTVTDATVTVINALPSEARSQLLRELLTSDGENSADFSFL
RHTIGASDLSGPPAYTYEDTEGGFGLGDRGTAMAKLLAEMKGIRSDAIVLGSAWSAPAYM
KVNRQLTGNADGNWLDSQYYSNYADYFVQYLQAYADLGVAVDAITIQNEPLNNQGGGHVT
MAQSAEEAGRVTQEFVGPALRAAGGLDNVEIWAYDHNTDEPSYPQTVVDAAGEYVQAAAW
HCYQTDVDWSVISAFKEANPDKKNHMTECWTSHSTPWYQSSRNTVGPLQNWVEASGMWTL
GTWTRSGDTYGPYIPGGCGTCRGLFVVDEAAGTYEYTVDYYVLAQLSKFIPKGATILSGT
GSYSYEGYTGIQSVASLNPDGTRTVVIENTFGNDVQITLETSSGETWNGNVFANSVVTWI
LP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcaccaccaccctttcactcctcgctggccatgctttcgcaacagcggtccgg
ccatcggtgaggacccgtcaagcctcagcacaagccttcgccaccaaccaagacctgacc
tacaaactaacctcggtcgacgcgccggtagtggggcctggctcaggcggcgactcaccc
tggaacctgacgattgacgataccgaggcgggccacaagcagacggtggcgggattcggc
ggcaccgtcacggacgcgacagtgacggtgatcaacgcgctcccgtccgaggcgcggtcc
cagctgctgcgggaactcctgacctccgacggcgaaaacagcgcggacttcagcttcttg
cgccacacgatcggggcctcggatctgtccggcccgccggcgtacacgtatgaggacacc
gagggcgggttcgggctcggcgatcgcgggaccgcgatggcaaagctgctcgcggagatg
aagggcatccggtccgatgccatcgtcctgggaagcgcgtggagtgccccggcgtatatg
aaggtcaacaggcaactcaccgggaatgccgacggcaactggctcgactcgcagtactac
agcaactacgcggactatttcgtgcagtacctgcaagcgtacgcggacctgggggtcgcc
gtagacgccatcacgatccagaacgagccgctgaacaaccaggggggcggccacgtgacg
atggcgcagtcggcggaggaagcagggcgggtgacgcaggagttcgtgggaccggcgctt
cgcgccgccggggggctcgacaacgtggagatctgggcgtacgaccacaacacggacgag
ccgtcttacccgcagaccgtggtagacgcggcgggcgagtacgtccaggcggcggcgtgg
cattgctaccagacggacgtggactggagtgtcatcagcgccttcaaggaggcgaacccg
gacaagaagaaccacatgacggagtgctggacgtcgcattcgacaccgtggtaccagtcc
tctcgcaacactgtcggtccgctgcagaactgggtggaggcctcgggcatgtggacgctg
gggacgtggacgcggtcgggcgatacctacggaccgtacattccggggggctgtgggacg
tgccgaggtctcttcgtggtggatgaggcggctgggacatacgagtatacggtcgattac
tacgtgttggctcagttatctaagtttatcccaaagggtgccacgatcctcagcggaact
gggagttacagctacgagggctacacgggaatccagtcggtcgcctctttgaaccccgat
ggtacgcggactgttgttatcgagaacacgtttggaaacgacgttcagataaccttggag
actagcagtggcgagacctggaatggtaatgtcttcgcgaatagtgtcgtcacttggatc
ttgccgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system