KEGG   Eutypa lata: UCREL1_6196Help
Entry
UCREL1_6196       CDS       T03103                                 

Definition
putative alkaline phosphatase protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ela  Eutypa lata
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UCREL1_6196
Enzymes [BR:ela01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     UCREL1_6196
Exosome [BR:ela04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UCREL1_6196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 457 aa AA seqDB search
MARDYVSLLQNGENPDAPVGMQLAADKLVLGNVQTLSSDNLITDSAAAATAFACGVKTYN
DAVGVDATGSPVGTILEAAHLAEYKTGLVVTSVINHATPACYSSHVLDRNSYEDIAAQQI
GYSHPLGSIVDLLFGGGRCYYKPQSDSSSCRSDDVDLFGWAEEQGYHVMQDKDGFDELEE
GLGEKAKLPYIGLFNDDQMMYEIDRSKKQTEPSLLEMVATAINTLDSATADSEKGYFLMI
EASRIDHAGHANDPAAHVHDIIMYNDVVDYVRGWIDEHPDTLMLSAADHECGGLTLNGFD
PLPLKSVNASLEEIQRLWDAYDGSDKRAYLVDEILPASGLDDLSDEEIDELAAMDSDDLI
ADFSSKISDKAGVNWSTGGHSAVDVTLIGYGAGSKLSELRADLGGNRDNTELPRYIEKIL
NVDIDGVTDILKANGTGWVGERKVDKRHMEHHLRHMH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcgagggactacgtctcgctgctgcaaaacggcgagaaccctgatgcacccgtcggc
atgcaactcgcagccgataagctagtgcttggcaacgtccagactctgtctagcgacaac
ctgatcacagattcagccgccgcggctactgcgttcgcctgcggcgtcaagacctataat
gacgcggtcggcgtcgatgccaccggctcgccagtcggaaccatcctggaagcggcgcac
ctggccgagtacaagaccgggttggtagtgacttcggtaatcaaccacgcgacgccggcc
tgctactcgtcgcacgtcctcgaccgtaactcgtacgaggacatcgcggcccagcagatc
gggtactcgcacccgctcggctccatcgttgacctgctgtttggcggtgggcggtgttac
tacaagccccagagcgattcctcgtcctgcaggagcgacgacgtcgacttgtttggctgg
gccgaggaacaaggctaccacgtgatgcaggacaaagacgggttcgacgagctcgaggag
ggtctgggtgagaaagcgaaactgccgtacattgggctcttcaacgacgaccagatgatg
tacgagatcgaccgttctaagaaacagacggagccctcgcttctcgagatggtcgcgacg
gccattaatacgttagatagcgcgaccgcggacagcgagaagggatactttctcatgatc
gaggcgagcagaatcgaccacgcaggccatgccaatgatcccgcggctcacgtccacgac
atcatcatgtacaacgacgtcgtggactatgtgagggggtggatcgacgagcacccggac
acgctaatgctgagcgcagctgaccacgaatgcggcggcttaaccctgaacgggttcgat
ccacttccgcttaagagtgtgaacgccagcctggaggaaatccagcgcctgtgggatgcc
tacgacggttctgacaagagggcgtacctcgtagacgagatcctgccggcttctgggtta
gatgacctatcggacgaggagatcgacgaacttgccgccatggacagcgatgacctgatt
gctgatttctccagcaagatcagcgataaggcaggagtgaactggtccactggcggtcac
agtgctgttgacgtgactctcatcggatacggtgccggctcgaaactctcggagttaaga
gcggatttggggggcaatcgagataacaccgagcttccacgctatatcgagaagattctc
aacgttgatattgacggggtcacggatattttgaaggcaaatggaacaggctgggttgga
gaacgaaaggttgacaagagacatatggaacatcatctacgtcatatgcattga

DBGET integrated database retrieval system