KEGG   Eutypa lata: UCREL1_7797Help
Entry
UCREL1_7797       CDS       T03103                                 

Definition
putative delta 9-fatty acid desaturase protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ela  Eutypa lata
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    UCREL1_7797
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    UCREL1_7797
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     UCREL1_7797
Lipid biosynthesis proteins [BR:ela01004]
 Desaturase
  First
   UCREL1_7797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 192 aa AA seqDB search
MGEGYHNFHHQFPVDYRNAIKWYQYDPTKWFIQLSEYLRLSTNLQTFPENEIKKGTLTMS
LKKLRAEQDDILWPPGSKELPVVDWDTYQKESEMTPLVLINGYIHDVSGFEEKHPGGRSI
LMRHVGKDASSAFSGGVYEHSNAAHNLLAMMRVGVLDGGVEHVKYVTPAQRLRVIEQRKH
DGVEPLEPVPAS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaggataccataacttccaccaccaattccctgtcgactaccggaatgctatc
aagtggtaccaatatgaccctaccaaatggttcattcagctgtctgaatatctgaggtta
tccacgaacctacagacgttccctgaaaacgagatcaagaagggaacgctcaccatgagc
ctgaagaagttaagagccgagcaagatgatatcctatggccgcctggatctaaggaattg
cccgttgtggattgggacacataccagaaagagtcggagatgaccccgcttgttttgatc
aacggctatatccacgatgtctctgggttcgaagagaaacacccgggcggtcgctcgatc
ctcatgcggcacgtcggaaaggatgctagcagcgcctttagtggcggcgtgtatgaacac
tccaacgcagcgcacaacttgctcgctatgatgcgcgtcggtgtactcgatggtggtgtc
gagcacgtcaaatacgtcactccagcgcagaggctccgagtcatcgagcaacggaagcat
gacggcgttgagcccctcgagcctgttccagctagctga

DBGET integrated database retrieval system