KEGG   Escherichia coli clone D i14: i14_0459Help
Entry
i14_0459          CDS       T02003                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00860  Porphyrin and chlorophyll metabolism
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01120  Microbial metabolism in diverse environments
Module
elc_M00121  Heme biosynthesis, glutamate => heme
elc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    i14_0459 (hemB)
Enzymes [BR:elc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     i14_0459 (hemB)
Exosome [BR:elc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   i14_0459 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: AER87970
Structure
PDB: 

Jmol
Position
complement(465502..466509)
Genome map
AA seq 335 aa AA seqDB search
MLLDSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEA
MPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQT
VPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMD
GQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREA
IRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFSALAGAID
EEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcgattccacaaacatcaggcagaccatgacagatttaatccaacgccctcgt
cgcctgcgcaaatctcctgcgctgcgcgctatgtttgaagagacaacacttagccttaac
gacctggtgttgccgatctttgttgaagaagaaattgacgactacaaagccgttgaagcc
atgccaggcgtgatgcgcattccagagaaacatctggcacgcgaaattgaacgcatcgcc
aacgccggtattcgttccgtgatgactttcggcatctctcaccataccgatgaaaccggc
agcgatgcctggcgggaagatggactggtggcgcgtatgtcgcgcatctgcaagcagacc
gtgccagaaatgatcgttatgtcagacacctgcttctgtgaatacacatctcacggtcac
tgcggtgttctgtgcgagcatggcgtcgacaacgacgcgactctggaaaatttaggcaag
caagctgtggttgcagctgctgcaggcgcagacttcatcgccccttctgccgcgatggat
ggtcaggtacaggcgattcgccaggcgctggacgctgcgggctttaaagatacggcgatt
atgtcgtattcgaccaagttcgcctcctccttttatggcccgttccgtgaagctgccgga
agcgcattaaaaggcgaccgcaaaagctatcagatgaacccaatgaaccgtcgtgaggcg
attcgtgagtcgctgctggatgaagcccagggcgcagactgcctgatggttaaacctgcc
ggagcatacctcgacatcgtgcgtgagctgcgtgaacgtactgaattgccgattggcgcg
tatcaggtgagcggtgagtacgcgatgattaagttctccgcgctggcgggtgctatagat
gaagagaaagtcgtgctcgaaagcttaggttcgattaagcgtgcgggtgcggatctgatt
ttcagctactttgcgctggatttggctgagaagaagattctgcgttaa

DBGET integrated database retrieval system