KEGG   Escherichia coli clone D i14: i14_0770Help
Entry
i14_0770          CDS       T02003                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
elc  Escherichia coli clone D i14
Pathway
elc00020  Citrate cycle (TCA cycle)
elc00190  Oxidative phosphorylation
elc00650  Butanoate metabolism
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01120  Microbial metabolism in diverse environments
elc01130  Biosynthesis of antibiotics
elc01200  Carbon metabolism
Module
elc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
elc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    i14_0770 (sdhD)
   00650 Butanoate metabolism
    i14_0770 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    i14_0770 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AER88277
Structure
PDB: 

Jmol
Position
782046..782393
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgt
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggattggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system