KEGG   Escherichia coli clone D i14: i14_0798Help
Entry
i14_0798          CDS       T02003                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00010  Glycolysis / Gluconeogenesis
elc00260  Glycine, serine and threonine metabolism
elc00680  Methane metabolism
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01120  Microbial metabolism in diverse environments
elc01130  Biosynthesis of antibiotics
elc01200  Carbon metabolism
elc01230  Biosynthesis of amino acids
Module
elc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elc_M00002  Glycolysis, core module involving three-carbon compounds
elc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    i14_0798 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    i14_0798 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    i14_0798 (gpmA)
Enzymes [BR:elc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     i14_0798 (gpmA)
Membrane trafficking [BR:elc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    i14_0798 (gpmA)
Exosome [BR:elc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   i14_0798 (gpmA)
  Exosomal proteins of melanoma cells
   i14_0798 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AER88305
Structure
PDB: 

Jmol
Position
complement(808534..809301)
Genome map
AA seq 255 aa AA seqDB search
MRSKYMAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFA
YTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQW
RRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKS
GERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADE
IAAKAAAVANQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaggagtaagtatatggctgtaactaagctggttctggttcgtcatggcgaaagtcag
tggaacaaagaaaaccgtttcaccggttggtacgacgtggatctgtctgagaaaggcgta
agcgaagcaaaagcagcaggtaagctgctgaaagaggaaggttacagctttgactttgct
tacacctctgtgctgaaacgcgctattcataccctgtggaatgtgttggacgaactggat
caggcatggctgcccgttgagaaatcctggaaactgaacgaacgtcactacggtgcgttg
cagggtctgaacaaagcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtgg
cgtcgtggttttgcggtgactccgccggaactgactaaagatgatgagcgttatccgggg
cacgatccgcgttacgcgaaactgagcgagaaagagctgccgctgacggaaagcctggcg
ctgaccattgaccgcgtgatcccttactggaatgaaaccattctgccacgtatgaagagc
ggtgagcgcgtcatcatcgccgcacacggtaactcgttacgtgcgctggtgaaatatctc
gataacatgagcgaagaagagattcttgagctgaatatcccgaccggcgtgccgctggtt
tatgagtttgacgagaacttcaaaccgctgaaacgctattatctgggtaatgctgacgag
atcgcggcgaaagcagcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system