KEGG   Escherichia coli clone D i14: i14_1734Help
Entry
i14_1734          CDS       T02003                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
elc  Escherichia coli clone D i14
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    i14_1734 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    i14_1734 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    i14_1734 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    i14_1734 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    i14_1734 (adhP)
   00626 Naphthalene degradation
    i14_1734 (adhP)
Enzymes [BR:elc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     i14_1734 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1689211..1690251)
Genome map
AA seq 346 aa AA seqDB search
MQNIIRKGGTMKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGD
KTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAG
YSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGL
GGLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAARIVQEKAGGAH
AAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDL
TEAFQFAAEGKVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacatcatccgaaaaggaggaactatgaaggctgcagttgttacgaaggatcat
catgttgacgttacggataaaacactgcgctcactgaaacatggcgaagccctgctgaaa
atggagtgttgtggtgtatgtcataccgatcttcatgttaagaatggcgattttggtgac
aaaaccggcgtgattctgggacacgaaggtattggtgtggtggcagaagttggccctggt
gttacttcattaaaaccaggcgatcgtgccagcgtggcgtggttctatgaaggatgcggt
cattgcgaatactgtaacagtggtaacgaaacgctctgccgttcagtaaaaaatgccgga
tacagcgttgatggcgggatggcggaagagtgcatcgtggtcgccgattacgcggtaaaa
gtgccagatggtctggactcggcggcggccagcagcattacctgtgcgggggtcactacc
tacaaagccgttaagctgtcaaaaattcgtccaggacagtggattgctatctacggtctt
ggcggtctgggtaacctcgccctgcaatacgcgaagaatgtctttaacgccaaagtgatc
gccattgatgtcaatgatgaacagttaaaactggcaaccgaaatgggtgcagatttagcg
attaactcacgcaccgaagacgccgccagaattgtgcaggagaaagccggtggcgctcac
gcagcggtggtgacagcggtagctaaagctgcgtttaactcggcggtggatgctgtccgt
gcaggtggtcgtgtcgtggctgtcggtctgccgccggagtctatgagcctggacatccca
cggctggtgctggatggtattgaagtggtcggttcgctggtcggcacgcgtcaggatcta
accgaagccttccagtttgccgccgaaggcaaagtggtgccgaaagtcgccctgcgtccg
ttagcggacatcaacaccatctttaccgagatggaagaaggcaaaatccgtggccgtatg
gtgattgatttccgtcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system