KEGG   Escherichia coli clone D i14: i14_1734Help
Entry
i14_1734          CDS       T02003                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00010  Glycolysis / Gluconeogenesis
elc00071  Fatty acid degradation
elc00350  Tyrosine metabolism
elc00625  Chloroalkane and chloroalkene degradation
elc00626  Naphthalene degradation
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01120  Microbial metabolism in diverse environments
elc01130  Biosynthesis of antibiotics
elc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    i14_1734 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    i14_1734 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    i14_1734 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    i14_1734 (adhP)
   00626 Naphthalene degradation
    i14_1734 (adhP)
Enzymes [BR:elc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     i14_1734 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N Methyltransf_31 Phage_holin_2_1 GFA DUF2284
Motif
Other DBs
NCBI-ProteinID: AER89223
Structure
PDB: 

Jmol
Position
complement(1689211..1690251)
Genome map
AA seq 346 aa AA seqDB search
MQNIIRKGGTMKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGD
KTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAG
YSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGL
GGLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAARIVQEKAGGAH
AAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDL
TEAFQFAAEGKVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacatcatccgaaaaggaggaactatgaaggctgcagttgttacgaaggatcat
catgttgacgttacggataaaacactgcgctcactgaaacatggcgaagccctgctgaaa
atggagtgttgtggtgtatgtcataccgatcttcatgttaagaatggcgattttggtgac
aaaaccggcgtgattctgggacacgaaggtattggtgtggtggcagaagttggccctggt
gttacttcattaaaaccaggcgatcgtgccagcgtggcgtggttctatgaaggatgcggt
cattgcgaatactgtaacagtggtaacgaaacgctctgccgttcagtaaaaaatgccgga
tacagcgttgatggcgggatggcggaagagtgcatcgtggtcgccgattacgcggtaaaa
gtgccagatggtctggactcggcggcggccagcagcattacctgtgcgggggtcactacc
tacaaagccgttaagctgtcaaaaattcgtccaggacagtggattgctatctacggtctt
ggcggtctgggtaacctcgccctgcaatacgcgaagaatgtctttaacgccaaagtgatc
gccattgatgtcaatgatgaacagttaaaactggcaaccgaaatgggtgcagatttagcg
attaactcacgcaccgaagacgccgccagaattgtgcaggagaaagccggtggcgctcac
gcagcggtggtgacagcggtagctaaagctgcgtttaactcggcggtggatgctgtccgt
gcaggtggtcgtgtcgtggctgtcggtctgccgccggagtctatgagcctggacatccca
cggctggtgctggatggtattgaagtggtcggttcgctggtcggcacgcgtcaggatcta
accgaagccttccagtttgccgccgaaggcaaagtggtgccgaaagtcgccctgcgtccg
ttagcggacatcaacaccatctttaccgagatggaagaaggcaaaatccgtggccgtatg
gtgattgatttccgtcgctaa

DBGET integrated database retrieval system