KEGG   Escherichia coli clone D i14: i14_1768Help
Entry
i14_1768          CDS       T02003                                 

Gene name
yneH
Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00220  Arginine biosynthesis
elc00250  Alanine, aspartate and glutamate metabolism
elc00471  D-Glutamine and D-glutamate metabolism
elc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    i14_1768 (yneH)
   00220 Arginine biosynthesis
    i14_1768 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    i14_1768 (yneH)
Enzymes [BR:elc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     i14_1768 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: AER89257
Position
complement(1731653..1732579)
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacggtagacggttcccga
ttggggattgctatctgtaccgttgacggacagctttttcaggccggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcaccattcaattct
ttagtgcaactggaaatggagcagggtattccgcgtaatccgtttattaatgccggtgcg
ctggtggtctgcgatatgttgcaagggcgattaagcgcacctcggcaacgtatgctggaa
gtcgtgcgcggcttaagtggtgtgtctgatatttcctacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaat
ttccatcatgacgtgacaaccgttctgcaaaactactttcattactgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggcgaatcaggggaaagctattcat
attgatgaacctgtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agcggtatgtaccagaacgcgggggagtttgcctggcgggtgggactaccggcaaaatct
ggcgttggtggcggtattgtggcgattgttccgcatgaaatggccatcgcagtctggagt
ccggaactggatgatgccggtaactcgcttgcgggcattgccgtccttgaacaattgacg
aaacaattagggcgttcagtttattaa

DBGET integrated database retrieval system