KEGG   Escherichia coli clone D i14: i14_1943Help
Entry
i14_1943          CDS       T02003                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00010  Glycolysis / Gluconeogenesis
elc00030  Pentose phosphate pathway
elc00051  Fructose and mannose metabolism
elc00052  Galactose metabolism
elc00680  Methane metabolism
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01120  Microbial metabolism in diverse environments
elc01130  Biosynthesis of antibiotics
elc01200  Carbon metabolism
elc01230  Biosynthesis of amino acids
Module
elc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    i14_1943 (pfkB)
   00030 Pentose phosphate pathway
    i14_1943 (pfkB)
   00051 Fructose and mannose metabolism
    i14_1943 (pfkB)
   00052 Galactose metabolism
    i14_1943 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    i14_1943 (pfkB)
Enzymes [BR:elc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     i14_1943 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: AER89432
Structure
PDB: 

Jmol
Position
1903908..1904840
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGTATAIF
PAGGATGEHLVSLLAHENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctcttgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccggtggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcactgccacagcgatcttc
ccggcgggtggcgcgaccggcgaacatctggtttcactgttggcgcatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagctcgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaa
gggatccgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaactcagtgcgctggtaaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaa
cgggttgtcgtttccctgggtccacaaggggcgctgggcgttgatagtgaaaactgcatt
caggtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtc
ggcgcgatgacacttaaactggcagaaaatgcctctcttgaagagatggtccgttttggc
gtagctgcggggagtgcagccacactcaaccagggaacacgcctgtgctcccatgacgat
acgcaaaaaatttacgcgtacctttcccgctaa

DBGET integrated database retrieval system