KEGG   Escherichia coli clone D i14: i14_1991Help
Entry
i14_1991          CDS       T02003                                 

Gene name
ydjB
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
elc  Escherichia coli clone D i14
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:elc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1951543..1952202
Genome map
AA seq 219 aa AA seqDB search
MIKETAMPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWH
PANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLKQKAIAAVFHKGEN
PLVDSYSAFFDNGRRQKTALDDWLRAHVINELIVMGLATDYCVKFTVLDALQLGYKVNVI
TDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggagactgcaatgccccctcgcgccctgttactggtcgatttacaaaatgat
ttctgtgctggtggcgcgctcgccgtgccggaaggtgacagtacggtggatgtcgctaac
cgcctgattgactggtgccagtcgcgcggtgaagcggttatcgccagtcaggactggcac
ccggcgaatcacggcagttttgccagtcagcacggtgtagagccttatacgccgggccaa
ctcgacggtttgccacaaaccttctggcccgatcactgtgtgcagaacagtgaaggcgca
caattacatccgttactgaagcaaaaagcgatcgcagcggtgttccataaaggcgaaaat
cctttagttgacagttacagtgccttttttgataacggccgtcggcagaaaactgcgctc
gatgactggttgcgcgctcatgtaatcaatgaattgatcgttatgggtctggctactgac
tattgcgttaagtttaccgtgctggacgcgttacagttaggctataaggtgaacgtgatt
accgatggttgtcgtggcgtaaatatccagccacaggacagtgcgcacgcgtttatggag
atgtcagcagctggggcaacgctatatacgctggcagactgggaagaaacgcaggagtaa

DBGET integrated database retrieval system