KEGG   Escherichia coli clone D i14: i14_3202Help
Entry
i14_3202          CDS       T02003                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
elc  Escherichia coli clone D i14
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:elc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3227614..3229071
Genome map
AA seq 485 aa AA seqDB search
MTHLEPMIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKE
VVPGKYYPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFY
DDMIDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKY
WMTFNEINNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAAHRINP
EMKVGCMLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNI
KMEDGDLDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQID
PVGLRYALCELYERYQKPLFIVENGFGAYDKVEDDGSINDDYRIDYLRAHIEEMKKAVTY
DGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIAS
NGENL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttgactcatctggagcctatgatagtgaaaaaactcaccttaccgaaagatttcttatgg
ggcggcgcagttgccgctcatcaggtcgaaggcggctggaacaaaggcggcaaagggccg
agcatttgtgacgttttgaccggtggcgcacacggcgtgccgcgcgaaatcaccaaagaa
gttgtgcctggcaaatactatccaaaccatgaagccgttgatttttatggtcactacaag
gaggacatcaagctatttgccgaaatgggcttcaaatgttttcgtacttccatcgcctgg
acgcgcatttttccaaaaggcgatgaagctcagccaaacgaagaagggctgaagttctac
gatgatatgatcgatgaactgctgaaatacaacatcgaaccggtgatcaccctctcccac
tttgaaatgccgctgcatctggtgcagcaatacggtagctggaccaaccgtaaagtggtt
gatttctttgtccgtttcgcggaagtggtattcgaacgctataagcacaaagtcaaatac
tggatgaccttcaacgaaattaacaaccagcgtaactggcgtgcaccgctgttcggttac
tgctgctccggcgtggtgtataccgaacatgaaaacccggaagagaccatgtatcaggtg
ctgcatcaccagtttgtcgccagcgccctggcggtgaaagccgcgcatcgcatcaacccg
gagatgaaagtcggttgtatgctggcgatggtgccgctctatccttactcctgtaacccg
gacgatgtgatgtttgcccaggagtcgatgcgcgaacgttacgtctttaccgatgtgcag
ttgcgtggctattacccgtcctatgtgttgaacgagtgggaacgccgcggatttaacatc
aaaatggaagacggcgatctggatgtactgcgcgaaggcacctgcgattatctcggcttc
agctattacatgaccaacgcggtgaaggccgaaggtggcaccggcgatgcgatttctggt
ttcgaaggcagcgtaccgaatccgtatgttaaagcgtctgactggggctggcagattgat
ccggttggtctgcgctacgcactttgcgagctgtatgagcgttaccagaagccgctgttt
attgtcgaaaacggttttggcgcttacgacaaagtggaagatgatggcagcatcaatgac
gattaccgcattgattacctgcgtgcccatattgaagagatgaaaaaagcggtgacttac
gatggcgtggacctgatgggctacacgccgtggggctgcatcgactgtgtgtcgttcacc
accgggcagtacagcaaacgctacggctttatctatgtgaataaacatgacgacggtact
ggcgatatgtcgcgttcacgtaagaagagctttaactggtacaaagaggtgattgccagc
aacggcgagaatctgtaa

DBGET integrated database retrieval system