KEGG   Escherichia coli clone D i14: i14_3241Help
Entry
i14_3241          CDS       T02003                                 

Gene name
speB
Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00330  Arginine and proline metabolism
elc01100  Metabolic pathways
Module
elc_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    i14_3241 (speB)
Enzymes [BR:elc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     i14_3241 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AER90702
Position
complement(3265066..3265986)
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDKDNGFTVLDACQVNDRSVDDIIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcaatacgataactcactggtttccaacgcctttggtttttta
cgcctgccgatgaacttccagccatatgacagcgatgctgactgggtgattactggcgtg
ccgttcgatatggccacttctggtcgtgcgggtggtcgccacggtccggcagcgatccgt
caggtttcgacgaatctggcctgggaacacaatcgcttcccgtggaatttcgacatgcgt
gagcgcctgaacgtcgtggactgcggcgatctggtatatgccttcggagatgcccgtgag
atgagcgagaagctgcaggcgcacgccgagaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccactttgttacgctgccgctgctgcgcgctcatgcgaagcatttc
ggcaaaatggcgttggtacactttgatgcccacaccgatacctacgctaacggttgtgaa
tttgaccacggcaccatgttctataccgcgccgaaagaaggtctgatcgacccgaatcat
tctgtgcagattggtattcgtaccgagtttgataaagacaacggctttaccgtgctggac
gcctgccaggtgaacgatcgcagcgtggatgacattatcgcccaggtgaaacagattgtg
ggtgatatgccggtttacctgacctttgatatcgactgcctggatcctgcttttgcacca
ggcaccggtacgccggtaattggcggcctgacctccgatcgcgccattaaactggtacgc
ggcttgaaagatctcaacatcgttgggatggacgtagtggaggtggctccggcatacgat
cagtcggaaatcaccgctctggctgcggcgacgctggcgctggagatgctgtatatccag
gcggcgaaaaagggcgagtaa

DBGET integrated database retrieval system