KEGG   Escherichia coli clone D i14: i14_4336Help
Entry
i14_4336          CDS       T02003                                 

Gene name
pldA
Definition
(GenBank) phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00564  Glycerophospholipid metabolism
elc00565  Ether lipid metabolism
elc00590  Arachidonic acid metabolism
elc00591  Linoleic acid metabolism
elc00592  alpha-Linolenic acid metabolism
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    i14_4336 (pldA)
   00565 Ether lipid metabolism
    i14_4336 (pldA)
   00590 Arachidonic acid metabolism
    i14_4336 (pldA)
   00591 Linoleic acid metabolism
    i14_4336 (pldA)
   00592 alpha-Linolenic acid metabolism
    i14_4336 (pldA)
Enzymes [BR:elc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     i14_4336 (pldA)
    3.1.1.32  phospholipase A1
     i14_4336 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AER91776
Structure
PDB: 

Jmol
Position
4331209..4332078
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYI
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSDESSPFRETNYEPQLFLGFATDYNFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcaccctttatccttatgacaccaactacatc
atctacacccaaaccagcgatctgaataaagaagcgattgccagttacgactgggcggaa
aacgcgcgtaaggatgaagtaaagttccagttgagcctggcgtttccgctgtggcgtggg
attttggggccaaactctgtactgggcgcctcctacacacagaaatcctggtggcagctt
tctaatagcgatgagtcatcaccgtttcgtgaaactaactacgaaccgcaattgttcctc
ggttttgccacggattacaactttgctggctggacgctgcgcgatgtggaaatgggctac
aaccacgactcaaacgggcgttcagacccgacttcccgcagctggaaccgcctttatacc
cgcctgatggcagaaaacggtaactggctggtagaggtgaagccgtggtatgtggtgggg
aatacggacgataacccggacatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtactgagcgcgaaagggcagtacaactggaacaccggttac
ggcggcgcggagttaggcttaagctacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggttacggcgaatcgctcatcgactataacttcaaccagacccgcgttggt
gtgggagttatgctaaacgacctgttttga

DBGET integrated database retrieval system