KEGG   Escherichia coli clone D i14: i14_4461Help
Entry
i14_4461          CDS       T02003                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
elc  Escherichia coli clone D i14
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    i14_4461 (pfkA)
   01230 Biosynthesis of amino acids
    i14_4461 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    i14_4461 (pfkA)
   00030 Pentose phosphate pathway
    i14_4461 (pfkA)
   00051 Fructose and mannose metabolism
    i14_4461 (pfkA)
   00052 Galactose metabolism
    i14_4461 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    i14_4461 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    i14_4461 (pfkA)
Enzymes [BR:elc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     i14_4461 (pfkA)
Protein phosphatases and associated proteins [BR:elc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     i14_4461 (pfkA)
Messenger RNA biogenesis [BR:elc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     i14_4461 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4448946..4450004
Genome map
AA seq 352 aa AA seqDB search
MLYYLHIRWITSMCKKTSGNRFHFAFQSSEVVMIKKIGVLTSGGDAPGMNAAIRGVVRSA
LTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIE
NLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVV
EAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKA
GIAKGKKHAIVAITEHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRM
GAYAIELLLAGYGGRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgttatactatttgcacattcgttggatcacttcgatgtgcaagaagacttccggcaac
agatttcattttgcattccaaagttcagaggtagtcatgattaagaaaatcggtgtgttg
acaagcggcggtgatgcgccaggcatgaacgccgcaattcgcggggttgttcgttctgcg
ctgacagaaggtctggaagtaatgggcatttatgacggctatctgggtctgtatgaagac
cgtatggtacagctagaccgttacagcgtttctgacatgatcaaccgtggtggtacgttc
ctcggttctgcgcgtttcccggaattccgcgacgagaacatccgcgccgtggctatcgaa
aacctgaaaaaacgtgggatcgacgcgctggtggttatcggcggtgacggttcctacatg
ggtgcaatgcgtctgaccgaaatgggcttcccgtgcatcggcctgccgggcactatcgac
aacgacatcaaaggcactgactacactatcggtttcttcactgcgctgagcaccgttgta
gaagcgatcgaccgtctgcgtgacacctcttcttctcaccagcgtatttccgtggtggaa
gtgatgggccgttattgtggcgatctgacgttggctgcggctattgccggcggctgtgaa
ttcgttgtggttccggaagttgaattcagccgtgaagacctggtaaacgaaatcaaagcg
ggtatcgcgaaaggtaaaaaacacgcgatcgtggcgattaccgaacatatgtgtgatgtt
gacgaactggcgcatttcatcgagaaagaaaccggtcgtgaaacccgcgcaactgtgctg
ggccacatccagcgcggtggttctccggtgccttacgaccgtattctggcttcccgtatg
ggcgcttacgctatcgagctgctgctggcaggttacggtggtcgttgcgtaggtatccag
aacgaacagctggttcaccacgacatcatcgacgctatcgaaaacatgaagcgtccgttc
aaaggcgactggctggactgcgcgaaaaaactgtattaa

DBGET integrated database retrieval system