KEGG   Escherichia coli clone D i14: i14_4562Help
Entry
i14_4562          CDS       T02003                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
elc  Escherichia coli clone D i14
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:elc01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:elc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4570105..4571424
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWR
LLHGESKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPAN
SVPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDA
DAADLITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ELARRFAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGI
HSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEESQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacacaacaaattgaagaattacagaaagagtgg
actcaaccgcgttgggaaggcattactcgcccgtacagcgcggaagatgtggtgaaatta
cgcggttcagtcaatccggaatgcaccctggcgcaactgggtgcggcgaaaatgtggcgt
ctgctgcacggcgagtcgaaaaaaggctacatcaacagcctcggtgcactgactggcggt
caggcgctgcaacaggcgaaagcgggtattgaagcagtctatctgtcgggatggcaggta
gcggcggacgctaacctggcggccagcatgtatccggatcagtcgctctatccggcaaac
tcggtgccagcggtggtggagcggatcaacaatactttccgccgtgcggatcagatccaa
tggtccgcgggcattgagccgggcgatccgcgctatgtcgattacttcctgccgatcgtc
gccgatgcggaggccggttttggcggtgtactgaatgcctttgaactgatgaaagcgatg
attgaagccggtgcagcggcagttcacttcgaagatcagctggcatcagtgaagaaatgt
ggtcacatgggcggcaaagttttggtgccaactcaggaagctattcagaaactggtcgcg
gcgcgtctggcagctgatgtgacgggcgttccaaccctgctggttgctcgtaccgatgcc
gatgcggcggatctgattacctccgattgcgacccatatgacagcgaatttattactggc
gagcgtaccagtgaaggcttcttccgtactcatgcgggtattgagcaagcgatcagccgt
ggcctggcgtatgcgccatatgctgacctggtatggtgtgaaacctccacgccggaccta
gaactggcgcgtcgctttgcacaagccatccacgcgaaatatccgggcaaactgctggct
tataactgctcgccgtcgttcaactggcagaaaaacctcgacgacaaaactattgccagc
ttccagcagcagctgtcggatatgggctacaagttccagttcatcaccctggcaggtatc
cacagcatgtggttcaacatgtttgacctggcaaacgcctatgcccagggcgagggtatg
aagcactatgttgagaaagtgcagcagccggaatttgccgccgcgaaagatggctatacc
ttcgtatctcaccaacaggaagtgggtacaggttacttcgataaagtgacgaccattatt
caaggtggcacgtcttcagttaccgcgctgaccggctccaccgaagaatcgcagttctaa

DBGET integrated database retrieval system