KEGG   Escherichia coli clone D i14: i14_4621Help
Entry
i14_4621          CDS       T02003                                 

Definition
succinyl-CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
elc  Escherichia coli clone D i14
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    i14_4621
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    i14_4621
   00640 Propanoate metabolism
    i14_4621
   00660 C5-Branched dibasic acid metabolism
    i14_4621
Enzymes [BR:elc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     i14_4621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4635509..4636678
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKSLLAGMGMPCPKEIAIQQISQLADAWQHIACPSKGAVLKAQVHAGGRGKAG
GVKVLKQLPEAQAFVQQMLGSQLVTYQTGPEGQYVSSILLCENIYPVRQELYFGMVVDRE
SQRVTFIVSPEGGVEIEKVAHETPEKISSVSIDPLTGVQPCHIREMFAVLQLEHGLFAAF
SRLVNQAWKAFNELDFALLEINPLVLRETGEFMCADAKVSLDDNALYRHPELQVLRDETQ
EDPRESQAAKLDLNYVSLDGNIGCMVNGAGLAMATMDIIKLYGEQPANFLDVGGGATQER
VSEAFRLIVSDSKVKAILVNIFGGIVRCDMIARAIIHALNEARITLPVVVRLSGNNAAEG
QRLLAESGLTVEAVNSLDDAAKRIIALLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaggccaaatcgttactggctggcatggggatgccgtgtcca
aaagagatagccatccaacagatttcgcaactggcagatgcctggcaacatattgcttgc
ccgagtaaaggcgcggtacttaaagcgcaggtacatgctggtgggcgcggtaaagctggc
ggcgtaaaagtgcttaagcagctgccggaagcacaggcttttgtacagcaaatgttggga
tcgcaactggtgacttatcagaccgggccagaagggcagtatgtcagcagtattttgctg
tgcgaaaacatctatccggtacgccaggaactctattttggcatggtggtggatcgtgaa
agccagcgggtcacgtttattgtcagcccggaaggtggcgtggaaattgaaaaagtcgcc
catgagacaccggagaaaatcagcagtgtcagcattgatccactgacaggcgtgcagcct
tgccatatccgcgaaatgtttgctgttctgcaactggaacacgggctatttgctgccttt
agtcgcctggttaatcaggcgtggaaagcctttaacgaactggatttcgccctgctggaa
attaaccctctggtgttgcgggaaacgggcgaatttatgtgtgcagacgcgaaagtatcg
ctggatgataacgcgctgtatcgtcacccggaactccaggtgctacgtgatgaaacccag
gaagatccacgcgaaagccaggcagcgaagcttgatcttaattatgtctcgctggacgga
aatatcggctgcatggtcaatggtgcagggctggctatggcaaccatggacatcatcaag
ctatacggtgaacaacccgcaaacttcctggatgttggcggtggcgcaacccaggagcgc
gtcagtgaagcctttcggctgattgtttccgacagcaaagtgaaagccattctggttaat
atttttggtgggattgtccgttgcgacatgatcgccagagccattattcatgctctgaat
gaggcccgtatcaccctgcctgtcgtggtgcgtctctccggtaataacgctgccgaaggg
cagcggttactggcagaaagtggcctgacggtggaagccgtcaattctctggatgatgcc
gctaaacgcatcattgcgttactgaattaa

DBGET integrated database retrieval system