KEGG   Escherichia coli clone D i14: i14_4849Help
Entry
i14_4849          CDS       T02003                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
elc  Escherichia coli clone D i14
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:elc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:elc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4858191..4859126)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKF
DGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQAL
LALVLNRDLVL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctatatcagaaacatatcatttccataaacgaccttagtcgcgatgac
cttaatctggtgctggcgacagcggcgaaactgaaagcgaacccgcaaccagagctgttg
aagcacaaagttattgccagctgtttcttcgaagcctctacccgcacccgcctctctttc
gaaacttccatgcaccgcctgggtgccagcgtggtgggcttctccgacagcgccaataca
tcactgggtaaaaagggcgaaacgctggccgataccatttcggttatcagcacttacgtc
gatgcgatagtgatgcgtcatccgcaggaaggtgcagcgcgcctggccaccgagttttcc
ggcaatgtaccggtactgaatgccggtgatggctccaaccaacatccgacgcaaaccttg
ctggacttattcaccattcaggaaacccaggggcgtctggacaatctccacgtcgcaatg
gttggtgacctgaaatatggccgcaccgttcactccctgacccaggcgctagcgaagttc
gacggcaaccgtttttactttatcgcgccggatgcgctggcaatgccgcaatacattctg
gatatgctcgatgaaaaagggatcgcctggagtctgcacagctctattgaagaagtgatg
gcggaagtagacatcctgtacatgacccgcgtgcaaaaagagcgtctggacccgtccgag
tacgccaacgtgaaagcgcagtttgttcttcgcgccagcgatctccacaacgccaaagcc
aatatgaaagtgctgcatccgctgccgcgtgttgatgagattgcgacggatgtggataaa
acgcctcacgcctggtacttccagcaagcaggcaacgggattttcgctcgccaggcgtta
ctggcactggttctgaatcgcgatctggtactgtaa

DBGET integrated database retrieval system