KEGG   Escherichia coli clone D i14: i14_4872Help
Entry
i14_4872          CDS       T02003                                 

Gene name
idnK
Definition
D-gluconate kinase
Orthology
K00851  
gluconokinase [EC:2.7.1.12]
Organism
elc  Escherichia coli clone D i14
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    i14_4872 (idnK)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    i14_4872 (idnK)
Enzymes [BR:elc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     i14_4872 (idnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4883216..4883779
Genome map
AA seq 187 aa AA seqDB search
MAGESFILMGVSGSGKTLIGSKVAALLSAKFIDGDDLHPAKNIDKMSQGIPLSDEDRLPW
LERLNDASYSLYKKNETGFIVCSSLKKQYRDILRKGSPHVHFLWLDGDYETILARMQRRA
GHFMPVALLKSQFEALERPQDDEQDIVRIDINHDIANVTEQCRQAVLAIRQNRICAKEGS
ASDQRCE
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgaaagctttattttgatgggcgtttcagggagtggtaaaacattaattggt
agcaaggttgccgcgttattatctgctaaatttattgatggtgacgatcttcatccagcc
aaaaatatagataaaatgtcgcagggtattccattatctgatgaagatcgacttccctgg
ctggaacgcttaaatgatgcttcatacagtctttataaaaagaatgaaacaggatttatt
gtctgttcatcattaaaaaaacagtatcgtgatattttacgcaagggtagcccccatgtt
catttcctctggttagatggcgactatgaaactattctcgcgcgaatgcagcgtcgggct
gggcattttatgccggtagcgttactaaaaagtcagtttgaggcactggagcgtccacaa
gacgatgaacaggatattgtgcgcattgatatcaaccatgatattgccaatgtcaccgaa
caatgtcggcaggctgtgctggcgatacgacaaaacagaatatgtgcgaaagagggcagc
gcctcagatcagcgctgcgaatga

DBGET integrated database retrieval system