KEGG   Escherichia coli clone D i2: i02_0319Help
Entry
i02_0319          CDS       T02004                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eld  Escherichia coli clone D i2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    i02_0319
Enzymes [BR:eld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     i02_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
305946..306866
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCKLIVLQLEVQLETVYHAIEFGKKNGIEVLLNPAPALRELDMSYACKCDF
FIPNETELEILTGMSVDTYDHIRLAARSLVDKGLNNIIVTMSEKGALWMTRDQEVHVPAF
KVNAVDTSGAGDAFIGCFSHYYVQSGDVEAALKKAALFAAFSVTGKGTQSSYPSIEQFNE
FLTLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacattgcagttattggttccaatatggtggatctcattacttacacgaatcagatg
cctaaagaaggagaaactctggaagcacctgccttcaaaatcggatgtggtgggaaaggt
gctaatcaagcggtggcggcggctaaattgaattcaaaagtcctgatgctgactaaagta
ggtgatgatatttttgcggataatactattcgtaatctcgaatcatggggaattaatacc
acttatgttgagaaggtcccctgtaccagcagtggtgttgcaccgatctttgttaatgcc
aactcgagcaatagtatattaataattaagggagcgaataaatttctttccccggaagat
atcgatcgagctgcagaagatctgaaaaaatgcaaattgatcgttttacaactggaagtt
caactggaaacagtttaccacgcgattgagtttggtaagaaaaatggtattgaagtgtta
ttaaatccggctccggcattgcgtgagttagatatgtcttatgcctgcaaatgtgatttc
tttatcccgaatgaaacagaactggaaatattaaccggtatgtcggttgatacttatgat
catattcgtttggccgcacgttcgttagttgataaagggctgaacaatattattgttacc
atgagcgaaaaaggcgcattatggatgacccgtgatcaggaagtccatgttcctgcattc
aaagtaaatgctgttgatactagtggcgctggtgacgcatttattggttgcttttcccat
tattatgttcaaagcggtgatgttgaagccgctttgaaaaaagccgctctctttgccgct
ttcagcgtcacagggaaaggtacgcaatcatcttatccgagtattgaacaatttaatgaa
tttttaaccttaaacgaataa

DBGET integrated database retrieval system