KEGG   Escherichia coli clone D i2: i02_0718Help
Entry
i02_0718          CDS       T02004                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eld  Escherichia coli clone D i2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    i02_0718 (asnB)
Enzymes [BR:eld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     i02_0718 (asnB)
Peptidases [BR:eld01002]
 Cysteine Peptidases
  Family C44
   i02_0718 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(731198..733096)
Genome map
AA seq 632 aa AA seqDB search
MVSYFYPSLKSPHSIKPVKNYRSINKYTQKPSPFSSISNRHYVFYFSTAKSLAHRAALRH
FFNKQTQHAVNTRLTEKVMCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASD
NAILAHERLSIVDVNAGAQPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEV
ILALYQEKGPEFLDDLQSMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEM
KALVPVCRTIKEFPAGSYLWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKS
HLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLK
AAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGI
KMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARV
PFLDKKFLDVAMRINPQDKMCGNGKMEKHILRECFEAYLPASVAWRQKEQFSDGVGYSWI
DTLKEVAAQQVSDQQLETARFRFPFNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVA
CSSAKAIEWDEAFKKMDDPSGRAVGVHQSAYK
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtggtttcttatttttacccatcattaaaatcaccccattcaataaaacccgtcaaaaat
tatcgatccatcaataaatatacccaaaagccctcccctttttcatcaatcagcaatcgc
cattacgttttttatttttccactgccaaatcgcttgcgcaccgtgctgctttgcggcat
ttttttaacaagcaaacacaacacgcagtaaacaccaggttaacggagaaggttatgtgt
tctatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaagcactc
gagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgccagcgat
aacgccattctcgcccacgaacgtctgtcaattgttgacgttaacgcgggggcgcaacct
ctctacaaccaacaaaaaactcatgtgctggcagtaaacggtgaaatctacaaccaccag
gcattgcgcgctgaatatggcgatcgttaccagttccagaccgggtctgactgtgaagtg
atcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagagcatgttt
gcctttgccctgtacgacagcgaaaaagatgcatatctgattggtcgcgaccatctgggg
atcatcccactgtatatgggctatgacgaacacggtcagctgtatgtggcctcagaaatg
aaagccctcgtgccagtttgccgcacgattaaagagtttccggcggggagctatttgtgg
agtcaggacggcgaaatccgttcttattatcatcgcgactggttcgactacgatgcggtg
aaagataacgtgaccgacaaaaacgagctgcgtcaggcactggaagattccgttaaaagc
catctgatgtctgatgtgccttacggtgtgctgctttctggtggtctggattcctcaatt
atttccgctatcaccaagaaatacgccgcccgtcgcgtggaagatcaggaacgctctgaa
gcctggtggccgcagttgcactcctttgctgtaggtctgccgggctcaccggatctgaaa
gcagcccaggaagtggcaaaccatctgggcacggtgcatcacgaaattcacttcactgta
caggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacttatgatgtgacc
actattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcgatgggcatt
aaaatggtgctgtccggtgaaggttctgacgaagtgtttggcggttatctatacttccac
aaagcgccgaacgctaaagagttgcatgaagagacggtgcgtaaactgctggccctgcat
atgtatgactgcgcgcgtgccaacaaagcgatgtcagcctggggcgtggaagcacgcgtt
ccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccacaggataaaatg
tgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgaagcgtatctgcct
gcaagcgtggcctggcggcaaaaagagcagttctccgatggcgtcggttacagttggatc
gacaccctgaaagaagtggcagcgcagcaggtttctgatcaacagctggaaactgcccgc
ttccgcttcccgttcaacacgccgacctcaaaagaagcgtatctgtaccgggagatcttt
gaagaattgttcccgcttccgagcgccgctgagtgcgtgccgggcggtccttccgtcgct
tgttcttccgctaaagcgattgagtgggatgaagcgttcaagaaaatggacgatccgtct
ggtcgcgcggttggcgttcaccagtcggcatataaataa

DBGET integrated database retrieval system