KEGG   Escherichia coli clone D i2: i02_1608Help
Entry
i02_1608          CDS       T02004                                 

Gene name
ycjM
Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eld  Escherichia coli clone D i2
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    i02_1608 (ycjM)
Enzymes [BR:eld01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     i02_1608 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1556435..1558141
Genome map
AA seq 568 aa AA seqDB search
MGPLPRKGNMKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVL
ITYADQFHSNDLKPLPTFNQFYPQWLQRIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAG
EWQDIQQLGECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAIDPKTDLSAVTRPR
ALPLLTPFQMRDHSMRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAV
GFMWKEPGTSCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGEGDDEAH
MVYQFSMPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPE
NEILALVEVLQQEGALVNWKNNPDGTRSPYEMNVTYMDALSRRECSDEERCARFILAHAI
LLSFPGVPAIYIQSILGSRNDYAGVEKLGYNRAINRKKYSSKEITTELNNKATLRYSIYY
KLSHLITLRRSHKEFHPDNNFTIDAINSFVMRIQRSNADGDCLTGLFNVSENIQHINITD
LHGRDLISEVDILGNEITLHPWQVMWIK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctaccacggaaaggcaacatgaaacagaaaattacggattacctggacgaa
atctacggtggaacatttaccgcgactcatttacagaaacttgtaacgcgtcttgagagt
gcgaaacgattaattacacagcgacgtaaaaaacactgggatgaaagtgatgtcgtgtta
attacctatgccgatcaatttcacagtaatgatttaaagccactacccacatttaatcag
ttttaccctcaatggctgcaaagaattttttcacatgttcatttattacctttttatcca
tggtcatctgatgatggattttcggtaattgattatcatcaggtcgccagtgaagcgggg
gagtggcaggatattcagcaactcggtgaatgcagccatttaatgtttgattttgtctgc
aaccatatgtcggcaaaaagtgaatggtttaaaaactatttacaacagcagccaggtttt
gaagatttttttattgccattgatccgaaaaccgatctcagcgccgtcactcgcccgcgt
gcgttaccgttattaacgccattccagatgcgcgatcattcaatgcgccatttatggacc
acctttagcgacgatcaaattgacctcaattaccgtagccctgaagtgttgctggcgatg
gtggatgtattgctgtgctacctggaaaagggcgcagagtatgtccgtctggatgccgtt
ggctttatgtggaaagagccgggaacaagctgcatccatctggaaaaaacacatctgatt
atcaaactgttacggtcgattattgataacgtcgcgccaggcacagtgatcattaccgag
accaatgttccgcataaagacaacattgcttactttggcgaaggcgatgacgaagcgcat
atggtgtaccagttctcgatgccgccgctggtgctgcatgcggtgcaaaaacagaacgtt
gaggcactttgtgcgtgggcgcaaaacctgacactaccttccagcaacaccacctggttt
aacttccttgcctctcacgatggcatcgggcttaacccactgcgggggttgttgcccgaa
aacgaaatattagcgctggtcgaggtgttacagcaggaaggggcattagtaaactggaaa
aataatcccgacggtacgcgtagcccctatgaaatgaatgtcacctatatggatgcgttg
agccgccgtgagtgtagcgacgaagaacggtgtgccaggtttattctcgcccatgcgatt
ttgttaagttttcccggtgtgccagcgatatatattcaaagcattctggggtcgcgtaat
gattacgcaggtgtcgaaaaacttggatataatcgcgcgattaaccgtaaaaaatactct
agtaaagagataacgacagaactgaacaataaagcgacattaaggtattcgatatattat
aagttgtcgcatttaattacacttcgtcgcagtcataaagagtttcatccggataataat
ttcaccattgatgcgattaattcatttgtaatgcgaattcaaagaagcaatgcggatggc
gattgcctgacgggattgtttaatgtcagtgaaaatattcagcatataaatattactgac
ctgcacggtcgggatctgattagtgaagttgatatattgggtaatgaaataacactgcat
ccctggcaggttatgtggattaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system