KEGG   Escherichia coli clone D i2: i02_3524Help
Entry
i02_3524          CDS       T02004                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
eld  Escherichia coli clone D i2
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eld00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eld00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3534009..3537137
Genome map
AA seq 1042 aa AA seqDB search
MNGSDFSLPGGPMNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLPLSGQW
NFHFFDHPLQVPEAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDN
PTGAYQRIFTLSDGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKT
GDNLLCVRVMQWADSTYVEDQDMWWSAGIFRDVYLIGKQLTHINDFTVRTDFDEAYCDAT
LSCEVVLENLAASPVVTTLEYTLFDGEHVVHSSAIDHLAIEKLTSARFAFTVEQPQQWSA
ESPYLYHLVMTLKDADGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRK
GRAVGMDRVEKDLQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANV
GDISRITDDPQWENVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDD
TRLVHYEEDRDAEVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQ
NVFYKHDCIQGHYVWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTP
GPGLKEYKQVIAPVKIHALDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKL
RDVAPNSEAPLQITLPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVP
FAPNNARPLTLEDDRLSCTVRGYNFAITFSKTSGKPTSWQVNGESLLTREPKINFFKPMI
DNHKQEYEGLWQPNHLQIMQEHLRDFVVEQSDDEVLLVSRTVIAPPVFDFGMRCTYIWRI
AADGQVNVALSGERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDI
WRSTVDAMFENYPFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAA
QHCNELQRSDDITLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQ
SLASYEFGAGFFSTNLHSENKQ
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgaatggttccgatttctctctaccgggaggccctatgaatcgctgggaaaacattcag
ctcacccacgaaaaccgacttgcgccgcgtgcgtactttttttcatatgattctgttgcg
caggctcgtacttttgcccgtgaaaccagcagcctgtttctgcccttaagcggtcagtgg
aatttccacttttttgaccatccgctgcaagtgccagaagccttcacctctgagttaatg
gctgactgggggcatattaccgtccccgccatgtggcaaatggaaggtcacggcaaactg
caatataccgacgaaggttttccgttccccatcgatgtgccgtttgtccccagcgataac
ccaaccggtgcctatcaacgtattttcaccctcagcgacggctggcagggtaaacagacg
ctgattaaatttgacggcgtcgaaacctattttgaagtctacgttaacggtcagtatgtg
gggttcagcaagggcagtcgcctgaccgcagagtttgacatcagcgcgatggttaaaacc
ggcgacaacctgttgtgtgtgcgcgtgatgcaatgggcggactctacctacgtggaagac
caggatatgtggtggtcggcggggatcttccgcgatgtttatctgatcggaaaacaactc
acgcacattaacgatttcaccgtgcgcaccgactttgacgaagcctattgcgatgccaca
ctttcctgcgaagtggtgctggaaaatctcgccgcctcccctgtcgtcacgacgctggaa
tataccctgtttgatggcgaacacgtggtgcacagcagcgccattgatcatttggcaatt
gaaaaactgaccagcgcccgctttgcttttactgtcgaacagccgcagcaatggtcagca
gaatccccttatctttaccatctggtcatgacgctgaaagacgccgacggcaacgttctg
gaagtggtgccacaacgcgttggcttccgtgatatcaaagtgcgcgacggtctgttctgg
atcaataaccgttatgtgatgctgcacggcgtcaaccgccacgacaacgatcatcgcaaa
ggccgcgccgttgggatggatcgcgtcgagaaagatctccagttgatgaagcagcacaac
atcaactccgtgcgtaccgctcactacccgaacgatccacgtttttacgaactgtgcgat
atctacggcctgtttgtgatggcggaaaccgacgtcgaatcgcacggctttgctaatgtc
ggcgatatcagccgtattaccgacgatccgcagtgggaaaacgtctacgtcgagcgcatt
gttcgccatattcacgcgcagaaaaaccatccgtcgatcatcatctggtcgctgggcaat
gaatccggctatggctgtaacatccgcgcgatgtaccatgcggcgaaggcgctggatgac
acgcgactggtgcattacgaagaagatcgcgatgctgaagtggtcgatattatttccacc
atgtacacccgcgtgccgctgatgaatgagtttggtgaatacccgcatccgaagccgcgc
atcatctgtgaatatgctcatgcgatggggaacggaccgggcgggctgacggagtaccag
aacgtcttctataagcacgattgcattcagggacattatgtctgggaatggtgcgaccac
gggatccaggcgcaggatgacaacggcaacgtctggtacaaattcggcggcgactacggc
gactatcccaacaactataacttctgtcttgatggtttgatctattccgatcagacgccg
ggaccaggcctgaaagagtacaaacaggttattgcgccggtaaaaatccacgcgctggat
ctgactcgcggcgagttgaaagtcgaaaataaactgtggtttaccacgctagatgactac
accctgcacgcagaggtgcgcgccgaaggtgaaacgctcgcgacgcaacagattaaactg
cgcgacgttgcgccgaacagcgaagcccccttacagatcacgctgccgcagctggacgcc
cgcgaagcgttcctcaacattacggtgaccaaagattcccgcacccgctacagcgaagcc
gggcattctatcgccacttatcagttcccgctgaaggaaaacaccgcgcagcctgtacct
ttcgcaccgaataacgcccgtccgctgacgctggaagacgatcgtttgagctgtactgtt
cgcggctacaactttgcgatcaccttctcaaaaacgagtggtaaaccgacatcctggcaa
gtgaatggcgagtcgctgctgacccgcgagccaaagatcaacttcttcaagccgatgatc
gacaaccataagcaggagtacgaagggctgtggcagccaaatcatttgcagatcatgcag
gagcatctgcgcgattttgtcgttgagcaaagtgatgatgaagtgttgctagtcagccgc
acggttattgccccaccggtgtttgacttcgggatgcgctgcacctacatctggcgcatc
gctgccgatggccaggttaacgtggcgctttccggcgaacgttatggcgactatccgcac
atcattccgtgcatcggtttcaccatgggaattaacggcgaatacgaccaggtggcgtat
tacggacgtggaccgggcgaaaactacgccgacagccagcaggctaacatcattgatatc
tggcgcagcaccgtcgatgccatgttcgagaactatcccttcccgcagaacaacggtaac
cgtcagcatgtccgctggacggcactgactaaccgccacggcaacggtctgctggtggtt
ccgcagcgaccaattaacttcagcgcctggcactatacccaggaaaacatccacgctgcc
cagcactgtaacgagctgcagcgcagtgatgacatcactctgaatctcgaccaccagctg
cttggcctcggctccaactcctggggcagcgaggtgctggactcctggcgcgtctggttc
cgtgacttcagctacggctttacgttgctgccggtttctggcggagaagctaccgcgcaa
agcctggcgtcgtatgagttcggcgcagggttcttttccacgaatttgcacagcgagaat
aagcaatga

DBGET integrated database retrieval system