KEGG   Escherichia coli clone D i2: i02_3524Help
Entry
i02_3524          CDS       T02004                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
eld  Escherichia coli clone D i2
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    i02_3524 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    i02_3524 (ebgA)
Enzymes [BR:eld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     i02_3524 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3534009..3537137
Genome map
AA seq 1042 aa AA seqDB search
MNGSDFSLPGGPMNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLPLSGQW
NFHFFDHPLQVPEAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDN
PTGAYQRIFTLSDGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKT
GDNLLCVRVMQWADSTYVEDQDMWWSAGIFRDVYLIGKQLTHINDFTVRTDFDEAYCDAT
LSCEVVLENLAASPVVTTLEYTLFDGEHVVHSSAIDHLAIEKLTSARFAFTVEQPQQWSA
ESPYLYHLVMTLKDADGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRK
GRAVGMDRVEKDLQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANV
GDISRITDDPQWENVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDD
TRLVHYEEDRDAEVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQ
NVFYKHDCIQGHYVWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTP
GPGLKEYKQVIAPVKIHALDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKL
RDVAPNSEAPLQITLPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVP
FAPNNARPLTLEDDRLSCTVRGYNFAITFSKTSGKPTSWQVNGESLLTREPKINFFKPMI
DNHKQEYEGLWQPNHLQIMQEHLRDFVVEQSDDEVLLVSRTVIAPPVFDFGMRCTYIWRI
AADGQVNVALSGERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDI
WRSTVDAMFENYPFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAA
QHCNELQRSDDITLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQ
SLASYEFGAGFFSTNLHSENKQ
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgaatggttccgatttctctctaccgggaggccctatgaatcgctgggaaaacattcag
ctcacccacgaaaaccgacttgcgccgcgtgcgtactttttttcatatgattctgttgcg
caggctcgtacttttgcccgtgaaaccagcagcctgtttctgcccttaagcggtcagtgg
aatttccacttttttgaccatccgctgcaagtgccagaagccttcacctctgagttaatg
gctgactgggggcatattaccgtccccgccatgtggcaaatggaaggtcacggcaaactg
caatataccgacgaaggttttccgttccccatcgatgtgccgtttgtccccagcgataac
ccaaccggtgcctatcaacgtattttcaccctcagcgacggctggcagggtaaacagacg
ctgattaaatttgacggcgtcgaaacctattttgaagtctacgttaacggtcagtatgtg
gggttcagcaagggcagtcgcctgaccgcagagtttgacatcagcgcgatggttaaaacc
ggcgacaacctgttgtgtgtgcgcgtgatgcaatgggcggactctacctacgtggaagac
caggatatgtggtggtcggcggggatcttccgcgatgtttatctgatcggaaaacaactc
acgcacattaacgatttcaccgtgcgcaccgactttgacgaagcctattgcgatgccaca
ctttcctgcgaagtggtgctggaaaatctcgccgcctcccctgtcgtcacgacgctggaa
tataccctgtttgatggcgaacacgtggtgcacagcagcgccattgatcatttggcaatt
gaaaaactgaccagcgcccgctttgcttttactgtcgaacagccgcagcaatggtcagca
gaatccccttatctttaccatctggtcatgacgctgaaagacgccgacggcaacgttctg
gaagtggtgccacaacgcgttggcttccgtgatatcaaagtgcgcgacggtctgttctgg
atcaataaccgttatgtgatgctgcacggcgtcaaccgccacgacaacgatcatcgcaaa
ggccgcgccgttgggatggatcgcgtcgagaaagatctccagttgatgaagcagcacaac
atcaactccgtgcgtaccgctcactacccgaacgatccacgtttttacgaactgtgcgat
atctacggcctgtttgtgatggcggaaaccgacgtcgaatcgcacggctttgctaatgtc
ggcgatatcagccgtattaccgacgatccgcagtgggaaaacgtctacgtcgagcgcatt
gttcgccatattcacgcgcagaaaaaccatccgtcgatcatcatctggtcgctgggcaat
gaatccggctatggctgtaacatccgcgcgatgtaccatgcggcgaaggcgctggatgac
acgcgactggtgcattacgaagaagatcgcgatgctgaagtggtcgatattatttccacc
atgtacacccgcgtgccgctgatgaatgagtttggtgaatacccgcatccgaagccgcgc
atcatctgtgaatatgctcatgcgatggggaacggaccgggcgggctgacggagtaccag
aacgtcttctataagcacgattgcattcagggacattatgtctgggaatggtgcgaccac
gggatccaggcgcaggatgacaacggcaacgtctggtacaaattcggcggcgactacggc
gactatcccaacaactataacttctgtcttgatggtttgatctattccgatcagacgccg
ggaccaggcctgaaagagtacaaacaggttattgcgccggtaaaaatccacgcgctggat
ctgactcgcggcgagttgaaagtcgaaaataaactgtggtttaccacgctagatgactac
accctgcacgcagaggtgcgcgccgaaggtgaaacgctcgcgacgcaacagattaaactg
cgcgacgttgcgccgaacagcgaagcccccttacagatcacgctgccgcagctggacgcc
cgcgaagcgttcctcaacattacggtgaccaaagattcccgcacccgctacagcgaagcc
gggcattctatcgccacttatcagttcccgctgaaggaaaacaccgcgcagcctgtacct
ttcgcaccgaataacgcccgtccgctgacgctggaagacgatcgtttgagctgtactgtt
cgcggctacaactttgcgatcaccttctcaaaaacgagtggtaaaccgacatcctggcaa
gtgaatggcgagtcgctgctgacccgcgagccaaagatcaacttcttcaagccgatgatc
gacaaccataagcaggagtacgaagggctgtggcagccaaatcatttgcagatcatgcag
gagcatctgcgcgattttgtcgttgagcaaagtgatgatgaagtgttgctagtcagccgc
acggttattgccccaccggtgtttgacttcgggatgcgctgcacctacatctggcgcatc
gctgccgatggccaggttaacgtggcgctttccggcgaacgttatggcgactatccgcac
atcattccgtgcatcggtttcaccatgggaattaacggcgaatacgaccaggtggcgtat
tacggacgtggaccgggcgaaaactacgccgacagccagcaggctaacatcattgatatc
tggcgcagcaccgtcgatgccatgttcgagaactatcccttcccgcagaacaacggtaac
cgtcagcatgtccgctggacggcactgactaaccgccacggcaacggtctgctggtggtt
ccgcagcgaccaattaacttcagcgcctggcactatacccaggaaaacatccacgctgcc
cagcactgtaacgagctgcagcgcagtgatgacatcactctgaatctcgaccaccagctg
cttggcctcggctccaactcctggggcagcgaggtgctggactcctggcgcgtctggttc
cgtgacttcagctacggctttacgttgctgccggtttctggcggagaagctaccgcgcaa
agcctggcgtcgtatgagttcggcgcagggttcttttccacgaatttgcacagcgagaat
aagcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system