KEGG   Escherichia coli clone D i2: i02_4012Help
Entry
i02_4012          CDS       T02004                                 

Gene name
yhjM
Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eld  Escherichia coli clone D i2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(3998930..4000042)
Genome map
AA seq 370 aa AA seqDB search
MKMNVLRSGLVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQS
YGMFFALAANDRAAFDNLLDWTQNNLAQGSLKEHLPAWLWGKKENSKWEVLDSNSASDGD
VWMAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRF
NPSYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTL
ISSYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPV
GFSAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLP
DWGQECANSH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatgaatgtgttgcgtagtggactcgtgacgatgctgctgctggctgcctttagt
gttcaggcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcag
gaagggcgcgtcatcgaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagt
tacggcatgttctttgccctggcggctaacgaccgtgcagctttcgataatcttctcgac
tggacgcagaacaatctcgctcagggttctttaaaagaacatttgcccgcctggctgtgg
ggcaagaaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgat
gtctggatggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttatacc
gacatcggcagcgcattgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctggg
ctgggctccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgtttt
aaccccagctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtgg
accacgctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggcttttcg
ccagactgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattg
atcagcagctacgacgctatccgcgtttacatgtgggtaggcatgatgcctgacagcgat
ccgcaaaaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaac
ggttatccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccggtc
ggtttttctgccgccatgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgc
cagcgcgtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctg
tttggacaaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacct
gactggggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system