KEGG   Escherichia coli clone D i2: i02_4271Help
Entry
i02_4271          CDS       T02004                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eld  Escherichia coli clone D i2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    i02_4271 (rbsK)
Enzymes [BR:eld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     i02_4271 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4260232..4261188
Genome map
AA seq 318 aa AA seqDB search
MAHFMDIPNMQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAA
GRSGANIAFIACTGDDSIGESVRQQLATDNIDISPVSVIKGESTGVALIFVNGEGENVIG
IHAGANAALSPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPAR
ELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWA
SVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGA
QPSVPWREEIDAFLDRQR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcattttatggacatcccgaatatgcaaaacgcaggcagcctcgttgttcttggc
agcattaatgctgaccacattcttaatcttcaatcttttcctactccaggcgaaaccgta
accggtaaccactatcaggttgcatttggcggcaaaggcgcgaatcaggcggtggctgct
gggcgtagcggtgcgaatatcgcgtttattgcctgcactggcgatgacagcattggtgag
agcgttcgccagcagctcgccactgataacatcgatatttctccggtcagcgtgatcaaa
ggcgaatcaacaggtgtggcgctgatttttgttaatggcgaaggtgagaatgtcatcggt
attcatgccggcgctaatgctgccctttccccggcgctggtggaagcgcaacgtgagcgt
attgccaacgcgtcagcattattaatgcagctggaatcaccactcgaaagtgtgatggca
gcggcgaaaatcgcccatcaaaataagactatcgttgcgcttaacccggctccggctcgc
gaacttcctgacgaactgctggcgctggtggacattattacgccaaacgaaacggaagca
gaaaagctcaccggtattcgtgttgaaaatgatgaagatgcagcgaaggcggcgcaggta
ctgcatgaaaaaggtatccgtactgtactgattactttaggaagtcgtggtgtatgggct
agcgtgaatggtgaaggtcagcgcgttcctggattccgggtgcaggctgtcgatactatt
gctgccggagatacctttaacggcgcgttaatcacggcgttgctggaagaaaaaccattg
ccagaggcgattcgttttgcccatgcagccgctgcgattgccgtaacacgtaaaggcgca
caaccttccgtaccgtggcgtgaagagatcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system