KEGG   Escherichia coli clone D i2: i02_4387Help
Entry
i02_4387          CDS       T02004                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eld  Escherichia coli clone D i2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    i02_4387 (fadB)
   01212 Fatty acid metabolism
    i02_4387 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    i02_4387 (fadB)
   00650 Butanoate metabolism
    i02_4387 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    i02_4387 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    i02_4387 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    i02_4387 (fadB)
   00310 Lysine degradation
    i02_4387 (fadB)
   00380 Tryptophan metabolism
    i02_4387 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    i02_4387 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    i02_4387 (fadB)
   00281 Geraniol degradation
    i02_4387 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    i02_4387 (fadB)
Enzymes [BR:eld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     i02_4387 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     i02_4387 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     i02_4387 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     i02_4387 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4376364..4378679)
Genome map
AA seq 771 aa AA seqDB search
MISAERDQIGISLIFYLHIFNTKYTLRCIWYDQITLRIQETDMLYKGDTLYLDWLEDGIA
ELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAM
AILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPITAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQAAV
LGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPDTVLASNTSTIPISELAN
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKDYRDAIDALFNANRFGQKNGLGFWRYKEDSKGKPKKEEDVVVDDLLAKVSQP
KRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVYGLGFPPFHGGAFRWLDTL
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGDLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctgccgagcgtgatcagatcggcatttccttaatattttatttgcatattttt
aacacaaaatacacacttcgatgcatctggtacgaccagatcaccttgcggattcaggag
actgacatgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgcc
gaactggtatttgatgccccaggttcagttaataaactcgacactgccaccgtcgccagc
ctcggcgaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgt
tcgaacaaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctc
gttcctgaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctg
gaagatctcccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgc
gaatgcgtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccg
gaaaccaaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctc
ggtgctgacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcg
ctgaaaatcggtctggtggatggtgtagtcaaagcagaaaaactggttgaaggggcgatg
gcgattttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaag
ctggaaccgctaaaactgagcaagattgaagccgccatgagcttcaccatcgctaaaggg
atggtcgcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccatt
gaagctgcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtc
ccgctggcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatat
gtaaaaggtaaagcgaagaaactcaccaaagatgttgaaaccccgaaacaggccgctgtg
ctgggcgcaggcattatgggcggcggcatcgcctaccagtctgcgtggaaaggcgtgccg
gttgtcatgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaa
ctgctgaacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatc
tccacaattcacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaa
gcggttgttgaaaacccgaaagtgaaaaaagcagtgctggcagaaaccgagcagaaagta
cgcccggataccgtactggcgtctaacacttcaaccattcctatcagcgaactggccaac
gcgctggaacgtccggaaaacttctgcgggatgcacttctttaacccggtccaccgaatg
ccgttagtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtc
gcctgggcgagcaagatgggcaaaacgccgattgtggttaacgactgccccggcttcttc
gtcaaccgtgtactgttcccctatttcgccggtttcagccagttgctgcgcgacggcgcg
gatttccgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggca
tatctgctggatgttgtgggcattgacaccgcgcatcacgcccaggctgtcatggcagca
ggcttcccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttaatgcc
aaccgctttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggt
aagccgaagaaagaagaagatgtcgtcgttgacgacctgctggcaaaagtgagccagccg
aagcgcgatttcagcgaggaagagattatcgcccgcatgatgatcccgatggtcaacgaa
gtggtccgctgtctggaagagggcattatcgccactccggcagaagcggatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcgttccgctggttggacaccctc
ggcagcgcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaa
gtaccggaaggtctgcgtaataaagcacgtcataacgaaccgtactatcccccggttgag
ccagcccgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system