KEGG   Escherichia coli clone D i2: i02_4461Help
Entry
i02_4461          CDS       T02004                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eld  Escherichia coli clone D i2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:eld01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eld01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eld00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:eld00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eld00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eld00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:eld00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4448946..4450004
Genome map
AA seq 352 aa AA seqDB search
MLYYLHIRWITSMCKKTSGNRFHFAFQSSEVVMIKKIGVLTSGGDAPGMNAAIRGVVRSA
LTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIE
NLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVV
EAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKA
GIAKGKKHAIVAITEHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRM
GAYAIELLLAGYGGRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgttatactatttgcacattcgttggatcacttcgatgtgcaagaagacttccggcaac
agatttcattttgcattccaaagttcagaggtagtcatgattaagaaaatcggtgtgttg
acaagcggcggtgatgcgccaggcatgaacgccgcaattcgcggggttgttcgttctgcg
ctgacagaaggtctggaagtaatgggcatttatgacggctatctgggtctgtatgaagac
cgtatggtacagctagaccgttacagcgtttctgacatgatcaaccgtggtggtacgttc
ctcggttctgcgcgtttcccggaattccgcgacgagaacatccgcgccgtggctatcgaa
aacctgaaaaaacgtgggatcgacgcgctggtggttatcggcggtgacggttcctacatg
ggtgcaatgcgtctgaccgaaatgggcttcccgtgcatcggcctgccgggcactatcgac
aacgacatcaaaggcactgactacactatcggtttcttcactgcgctgagcaccgttgta
gaagcgatcgaccgtctgcgtgacacctcttcttctcaccagcgtatttccgtggtggaa
gtgatgggccgttattgtggcgatctgacgttggctgcggctattgccggcggctgtgaa
ttcgttgtggttccggaagttgaattcagccgtgaagacctggtaaacgaaatcaaagcg
ggtatcgcgaaaggtaaaaaacacgcgatcgtggcgattaccgaacatatgtgtgatgtt
gacgaactggcgcatttcatcgagaaagaaaccggtcgtgaaacccgcgcaactgtgctg
ggccacatccagcgcggtggttctccggtgccttacgaccgtattctggcttcccgtatg
ggcgcttacgctatcgagctgctgctggcaggttacggtggtcgttgcgtaggtatccag
aacgaacagctggttcaccacgacatcatcgacgctatcgaaaacatgaagcgtccgttc
aaaggcgactggctggactgcgcgaaaaaactgtattaa

DBGET integrated database retrieval system