KEGG   Escherichia coli clone D i2: i02_4561Help
Entry
i02_4561          CDS       T02004                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00620  Pyruvate metabolism
eld00630  Glyoxylate and dicarboxylate metabolism
eld01100  Metabolic pathways
eld01110  Biosynthesis of secondary metabolites
eld01120  Microbial metabolism in diverse environments
eld01200  Carbon metabolism
Module
eld_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    i02_4561 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    i02_4561 (aceB)
Enzymes [BR:eld01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     i02_4561 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI BTV_NS2
Motif
Other DBs
NCBI-ProteinID: AER87076
Structure
PDB: 

Jmol
Position
4568471..4570090
Genome map
AA seq 539 aa AA seqDB search
MTRSCTMTEQATTIDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQ
QQDIDNGMLPDFISETASIRYADWKIRGIPSDLEDRRVEITGPVERKMVINALNANVKVF
MADFEDSLAPDWNKVIDGQINLRDAVNGTISYSNEAGKIYQLKPNPAVLICRVRGLHLPE
KHVTWRGETIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAED
RFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRV
LPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLDKVKADKS
LEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCAGERT
EEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPV
TKALFRQMLGEEMKVIASELGEERFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggagctgcacgatgactgaacaggcaacaacaatcgatgaactggcttttaca
aggccgtatggcgagcaggagaagcaaattcttactgccgaagcggtagaatttctgact
gagctggtgacgcattttacgccacaacgcaataaacttctggcagcgcgtattcagcag
cagcaggatatcgataacggaatgttgcctgattttatttcggaaacagcttccattcgt
tatgctgactggaaaattcgcgggattccttcggacttagaagatcgtcgcgtagagatt
accggacctgtagagcgcaagatggtgatcaacgcgctcaacgccaatgtgaaagtcttt
atggccgatttcgaagattcactggcaccagactggaacaaagtgatcgatgggcaaatt
aacctgcgcgatgcggttaacggcaccatcagctatagcaatgaagcaggcaaaatttat
cagctcaagcccaatccagcggttttgatttgtcgggtacgcggtctgcacttgccggaa
aaacatgtcacctggcgtggtgagacaatccccggtagcctgtttgattttgcgctctat
ttcttccacaactatcaggcactgttggcaaagggcagcggtccctatttctatctgccg
aaaacccagtcctggcaggaagcggcctggtggagcgaagtcttcagctatgcagaagat
cgctttaatctgccgcgcggcaccatcaaggcgacgttgctgattgaaacgctgcccgcc
gtgttccagatggatgaaatccttcacgcgctgcgtgaccatattgttggtctgaactgc
ggtcgttgggattacatcttcagttatatcaaaacattgaaaaactatcccgatcgcgtc
ctgccagacagacaggcagtgacgatggataaacccttcctgaatgcttactcacgcctg
ttgattaaaacctgccataaacgcggtgcttttgcgatgggcggcatggcggcgtttatt
ccgagcaaagatgaagagcgcaataaccaggtgctcgacaaagtaaaagcggataaatcg
ctggaagccaataacggtcacgatggcacatggatcgctcacccgggccttgctgatacg
gcaatggcggtattcaacgatattctcggctcccgcaaaaaccagcttgaggtgatgcgc
gaacaagacgcgccgattactgccgatcagctgctggcaccttgtgctggtgaacgcacc
gaagaaggtatgcgcgccaacattcgcgtggctgtgcagtacatcgaagcgtggatctct
ggcaatggctgtgtgccgatttatggcctgatggaagatgcggcgacggctgaaatttcc
cgtacctcaatctggcagtggatccatcatcaaaaaacgttgagcaatggcaaaccggtg
actaaagccttgttccgccagatgctgggcgaagagatgaaagtcattgccagcgaactg
ggcgaagaacgtttctcccatgggcgttttgacgatgccgcacgcttgatggaacagatc
accacttccgatgagttaattgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system