KEGG   Eggerthella lenta: Elen_0089Help
Entry
Elen_0089         CDS       T00984                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ele  Eggerthella lenta
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ele00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
118023..119024
Genome map
AA seq 333 aa AA seqDB search
MTQPSKNGENAVDMLAVARIAQGVDIAGFAGPDAVKLVAPAKVNLFLDIGAKRADGYHEA
VSIMHALMLHDVLRMKLAPGRGEGLSVDLSCVAREGLAMLDVPVESNIVAKAVRLLAEKL
GRTADETVVACLEKHIPAEAGLGGGSSDAAAALLGAAHLWGVPADDPRIEEAARSLGADV
AFFLHGGCACFTGVGDAFDHALAPMNGNVVLVKPEGGVSTAAAYRAFDEHPTAISEADRE
AALEAQRAADVPLRNNLVPVSEHLLPALVDIRLWASERADVQRVLMSGSGSAVFMQCATF
ADAGRVAAEARMRGWWARATMFGSARAAVVPNR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgagcaagaacggcgaaaacgccgtagacatgctggccgtggctcgcatc
gcgcagggcgtggacatcgcgggcttcgccggccccgatgccgtcaagctggtggcaccg
gcgaaagtgaatctgttcctcgacatcggcgcgaagcgcgcggacggctatcacgaggcc
gtcagcatcatgcatgcgctcatgctgcacgacgttttacgcatgaagctggcgccggga
cgcggagaaggtctatccgtcgatctctcgtgcgttgcgcgcgaagggctcgcgatgctc
gatgtgcccgtggagagcaacatcgtggcgaaggccgtgcgcttgctggctgaaaaattg
ggacgcacggctgacgagacggtggtcgcctgcctcgagaagcacatccccgccgaggcc
ggtttgggcggcggctcctccgacgccgccgcggcgctgctgggcgctgcgcacttgtgg
ggcgtgcctgccgacgatccgcgtatcgaggaagcagcacgaagcctgggtgccgacgtg
gcgttcttcctgcatggcggctgcgcttgcttcacgggcgtgggcgatgcgttcgaccat
gcccttgcgcccatgaacggcaacgtcgtgctcgtgaagcccgagggcggcgtgtccacg
gctgccgcgtaccgcgcgttcgacgagcatcccacggccatttccgaggccgatcgcgaa
gcagccctcgaagcccagcgcgccgccgacgtgccgctgcgcaacaacctcgtgcccgtt
tccgagcacctgcttccggcgctcgtggacatccgcttgtgggctagcgagcgcgccgac
gtgcagcgcgtgctcatgtcgggcagcgggtcggccgtgttcatgcagtgcgccacgttc
gccgatgcaggtcgcgtggccgccgaggcgcgcatgcgcggctggtgggcgcgtgctacc
atgtttggctcggcgcgtgcggccgtggtgccgaaccgctga

DBGET integrated database retrieval system