KEGG   Eggerthella lenta: Elen_0139Help
Entry
Elen_0139         CDS       T00984                                 

Definition
phosphoglucose isomerase
Orthology
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ele  Eggerthella lenta
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ele01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ele00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ele00030]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ele00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ele00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
192154..193872
Genome map
AA seq 572 aa AA seqDB search
MLSGDVEKLYPSAKALVKDCVASRIHAKDASLYDFSEEARACSEQYMGWTDLASNSPYSL
RDIQNFADSIIAQGLKTVVLIGQGGSTQAPMTITKYNKPDSSKITFKTLDSDSPVRVRAI
LAEAKPETTLFVISSKSGGTIEPRLALRAVRDAVADRISEEELVQHLVAITDPGSMLERQ
AREEGWAAVFSGQPTVGGRFSALSVFGLLPAALVGIDLEEFMAHAIDAERQCSEDAIDNP
AIGLASFLYDNYLQGRNKFTFLTQKRGRVLGLWIEQLVAESLGKDGQGILPNIEVDSLLL
KKDPGDRSAIVYLTRNDLWDERRNFEMSLSYIDPAIPRANYKIDSVEELAEHFVMWEYAI
AMCGYLMKICPFDQPDVASAKAVVLDILKEGQPEPDFVQDFIDEVHMGEVEVRLSPCFKD
CTDVRSALRALLGSIQPGDFFALNAFLPFTGEGRREALETIRHGVAEKRGVVSCLEVGPR
YLHSTGQLHKGGPNCGVFLILSADELKDIPLKQEAESLGSLAKAQASGDLVTLAERGRRV
VHLHLPDNSGVTLRQLAEVISDILETMTVPTA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctatccggtgatgtagaaaaactgtatccttccgcgaaagccctcgtgaaggactgc
gttgccagccgtatccatgccaaggatgcgagcctgtacgacttctcggaggaagcgcgc
gcgtgctccgagcaatacatgggatggacggaccttgcgagcaattcgccgtactccctg
cgcgacatccagaatttcgccgactcgatcatcgcccaagggctgaagacggtcgtgctc
atcggccagggcggttccacgcaggcgcccatgaccatcacgaaatacaacaagcccgat
tcgtcgaagatcacgttcaagacgctggactccgactcgcccgtgcgcgtgcgcgccatt
ttggccgaagcgaagcccgagaccacgctgttcgtgatctcgtcgaagagcggcggcacc
atcgagccgcgcctggccctgcgtgccgtgcgcgacgccgtggccgaccgcatcagcgaa
gaggagctggtgcagcacctcgtggccatcaccgaccccggctccatgcttgagcgccag
gcgcgcgaagaagggtgggccgcggtgttctccggccagcccaccgtgggcgggcgcttc
tccgcgctgtccgtgttcggcctgctgccggcggcgctcgtgggcatcgacctggaagag
ttcatggcgcacgccatcgacgccgagcgccagtgcagcgaggacgccatcgacaacccg
gccatcggcctggcatcgtttttgtacgacaactacctgcagggacgcaacaagttcacg
ttcctcacgcagaagcgcggccgcgttctgggtctgtggatcgagcagctggtggccgag
agcctgggcaaggacggccagggcattctgcccaacatcgaggtggactccctgctgctc
aagaaagacccgggcgatcgcagcgccatcgtgtacctcacgcgcaacgacctgtgggac
gagcgccgcaacttcgagatgagcctgtcctacatcgacccggccatcccgcgcgccaac
tacaagatcgactccgtcgaagagctggccgagcacttcgtgatgtgggaatacgccatc
gcgatgtgcggctacctcatgaagatctgccccttcgaccagcccgacgtggcgtcggcg
aaggccgtggtgctcgacatcctcaaggagggccagcccgagcccgacttcgtgcaggat
ttcatcgacgaggtgcacatgggcgaggtggaagtgcgcctgtctccgtgcttcaaagat
tgcaccgatgtccgcagcgcgctgcgtgcgctgctgggcagcattcaaccgggcgatttc
ttcgcgctcaacgcgttcttgccgttcacgggcgagggtcgacgcgaggcgctggaaacc
atccgtcacggcgtggctgagaagcgcggcgtggtatcctgcctggaagtgggtccgcgc
tacctgcactccaccggccagctgcacaagggcggcccgaactgcggcgtgttcctcatc
ctgtcggccgacgagctaaaggacatcccgctgaagcaggaggctgaaagcctgggctcg
ctggccaaggcgcaggcgtcgggcgacctcgttacgctggccgagcgcgggcggcgcgtg
gtgcacctgcacctgcccgacaactcgggcgttacgctgcgccagctggctgaagtgatt
tccgacatcctggaaaccatgacggtgccgacggcttag

DBGET integrated database retrieval system