KEGG   Eggerthella lenta: Elen_0139Help
Entry
Elen_0139         CDS       T00984                                 

Definition
(GenBank) phosphoglucose isomerase (PGI)
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ele  Eggerthella lenta
Pathway
ele00010  Glycolysis / Gluconeogenesis
ele00030  Pentose phosphate pathway
ele00500  Starch and sucrose metabolism
ele00520  Amino sugar and nucleotide sugar metabolism
ele01100  Metabolic pathways
ele01110  Biosynthesis of secondary metabolites
ele01120  Microbial metabolism in diverse environments
ele01130  Biosynthesis of antibiotics
ele01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Elen_0139
   00030 Pentose phosphate pathway
    Elen_0139
   00500 Starch and sucrose metabolism
    Elen_0139
   00520 Amino sugar and nucleotide sugar metabolism
    Elen_0139
Enzymes [BR:ele01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Elen_0139
Exosome [BR:ele04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Elen_0139
  Exosomal proteins of other body fluids (saliva and urine)
   Elen_0139
  Exosomal proteins of colorectal cancer cells
   Elen_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ACV54133
JGI: Elen_0139
UniProt: C8WJD1
Position
192154..193872
Genome map
AA seq 572 aa AA seqDB search
MLSGDVEKLYPSAKALVKDCVASRIHAKDASLYDFSEEARACSEQYMGWTDLASNSPYSL
RDIQNFADSIIAQGLKTVVLIGQGGSTQAPMTITKYNKPDSSKITFKTLDSDSPVRVRAI
LAEAKPETTLFVISSKSGGTIEPRLALRAVRDAVADRISEEELVQHLVAITDPGSMLERQ
AREEGWAAVFSGQPTVGGRFSALSVFGLLPAALVGIDLEEFMAHAIDAERQCSEDAIDNP
AIGLASFLYDNYLQGRNKFTFLTQKRGRVLGLWIEQLVAESLGKDGQGILPNIEVDSLLL
KKDPGDRSAIVYLTRNDLWDERRNFEMSLSYIDPAIPRANYKIDSVEELAEHFVMWEYAI
AMCGYLMKICPFDQPDVASAKAVVLDILKEGQPEPDFVQDFIDEVHMGEVEVRLSPCFKD
CTDVRSALRALLGSIQPGDFFALNAFLPFTGEGRREALETIRHGVAEKRGVVSCLEVGPR
YLHSTGQLHKGGPNCGVFLILSADELKDIPLKQEAESLGSLAKAQASGDLVTLAERGRRV
VHLHLPDNSGVTLRQLAEVISDILETMTVPTA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctatccggtgatgtagaaaaactgtatccttccgcgaaagccctcgtgaaggactgc
gttgccagccgtatccatgccaaggatgcgagcctgtacgacttctcggaggaagcgcgc
gcgtgctccgagcaatacatgggatggacggaccttgcgagcaattcgccgtactccctg
cgcgacatccagaatttcgccgactcgatcatcgcccaagggctgaagacggtcgtgctc
atcggccagggcggttccacgcaggcgcccatgaccatcacgaaatacaacaagcccgat
tcgtcgaagatcacgttcaagacgctggactccgactcgcccgtgcgcgtgcgcgccatt
ttggccgaagcgaagcccgagaccacgctgttcgtgatctcgtcgaagagcggcggcacc
atcgagccgcgcctggccctgcgtgccgtgcgcgacgccgtggccgaccgcatcagcgaa
gaggagctggtgcagcacctcgtggccatcaccgaccccggctccatgcttgagcgccag
gcgcgcgaagaagggtgggccgcggtgttctccggccagcccaccgtgggcgggcgcttc
tccgcgctgtccgtgttcggcctgctgccggcggcgctcgtgggcatcgacctggaagag
ttcatggcgcacgccatcgacgccgagcgccagtgcagcgaggacgccatcgacaacccg
gccatcggcctggcatcgtttttgtacgacaactacctgcagggacgcaacaagttcacg
ttcctcacgcagaagcgcggccgcgttctgggtctgtggatcgagcagctggtggccgag
agcctgggcaaggacggccagggcattctgcccaacatcgaggtggactccctgctgctc
aagaaagacccgggcgatcgcagcgccatcgtgtacctcacgcgcaacgacctgtgggac
gagcgccgcaacttcgagatgagcctgtcctacatcgacccggccatcccgcgcgccaac
tacaagatcgactccgtcgaagagctggccgagcacttcgtgatgtgggaatacgccatc
gcgatgtgcggctacctcatgaagatctgccccttcgaccagcccgacgtggcgtcggcg
aaggccgtggtgctcgacatcctcaaggagggccagcccgagcccgacttcgtgcaggat
ttcatcgacgaggtgcacatgggcgaggtggaagtgcgcctgtctccgtgcttcaaagat
tgcaccgatgtccgcagcgcgctgcgtgcgctgctgggcagcattcaaccgggcgatttc
ttcgcgctcaacgcgttcttgccgttcacgggcgagggtcgacgcgaggcgctggaaacc
atccgtcacggcgtggctgagaagcgcggcgtggtatcctgcctggaagtgggtccgcgc
tacctgcactccaccggccagctgcacaagggcggcccgaactgcggcgtgttcctcatc
ctgtcggccgacgagctaaaggacatcccgctgaagcaggaggctgaaagcctgggctcg
ctggccaaggcgcaggcgtcgggcgacctcgttacgctggccgagcgcgggcggcgcgtg
gtgcacctgcacctgcccgacaactcgggcgttacgctgcgccagctggctgaagtgatt
tccgacatcctggaaaccatgacggtgccgacggcttag

DBGET integrated database retrieval system