KEGG   Eggerthella lenta: Elen_0139Help
Entry
Elen_0139         CDS       T00984                                 

Definition
phosphoglucose isomerase
Orthology
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ele  Eggerthella lenta
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Elen_0139
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Elen_0139
   00030 Pentose phosphate pathway
    Elen_0139
   00500 Starch and sucrose metabolism
    Elen_0139
   00520 Amino sugar and nucleotide sugar metabolism
    Elen_0139
Enzymes [BR:ele01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Elen_0139
Exosome [BR:ele04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Elen_0139
  Exosomal proteins of other body fluids (saliva and urine)
   Elen_0139
  Exosomal proteins of colorectal cancer cells
   Elen_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
192154..193872
Genome map
AA seq 572 aa AA seqDB search
MLSGDVEKLYPSAKALVKDCVASRIHAKDASLYDFSEEARACSEQYMGWTDLASNSPYSL
RDIQNFADSIIAQGLKTVVLIGQGGSTQAPMTITKYNKPDSSKITFKTLDSDSPVRVRAI
LAEAKPETTLFVISSKSGGTIEPRLALRAVRDAVADRISEEELVQHLVAITDPGSMLERQ
AREEGWAAVFSGQPTVGGRFSALSVFGLLPAALVGIDLEEFMAHAIDAERQCSEDAIDNP
AIGLASFLYDNYLQGRNKFTFLTQKRGRVLGLWIEQLVAESLGKDGQGILPNIEVDSLLL
KKDPGDRSAIVYLTRNDLWDERRNFEMSLSYIDPAIPRANYKIDSVEELAEHFVMWEYAI
AMCGYLMKICPFDQPDVASAKAVVLDILKEGQPEPDFVQDFIDEVHMGEVEVRLSPCFKD
CTDVRSALRALLGSIQPGDFFALNAFLPFTGEGRREALETIRHGVAEKRGVVSCLEVGPR
YLHSTGQLHKGGPNCGVFLILSADELKDIPLKQEAESLGSLAKAQASGDLVTLAERGRRV
VHLHLPDNSGVTLRQLAEVISDILETMTVPTA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctatccggtgatgtagaaaaactgtatccttccgcgaaagccctcgtgaaggactgc
gttgccagccgtatccatgccaaggatgcgagcctgtacgacttctcggaggaagcgcgc
gcgtgctccgagcaatacatgggatggacggaccttgcgagcaattcgccgtactccctg
cgcgacatccagaatttcgccgactcgatcatcgcccaagggctgaagacggtcgtgctc
atcggccagggcggttccacgcaggcgcccatgaccatcacgaaatacaacaagcccgat
tcgtcgaagatcacgttcaagacgctggactccgactcgcccgtgcgcgtgcgcgccatt
ttggccgaagcgaagcccgagaccacgctgttcgtgatctcgtcgaagagcggcggcacc
atcgagccgcgcctggccctgcgtgccgtgcgcgacgccgtggccgaccgcatcagcgaa
gaggagctggtgcagcacctcgtggccatcaccgaccccggctccatgcttgagcgccag
gcgcgcgaagaagggtgggccgcggtgttctccggccagcccaccgtgggcgggcgcttc
tccgcgctgtccgtgttcggcctgctgccggcggcgctcgtgggcatcgacctggaagag
ttcatggcgcacgccatcgacgccgagcgccagtgcagcgaggacgccatcgacaacccg
gccatcggcctggcatcgtttttgtacgacaactacctgcagggacgcaacaagttcacg
ttcctcacgcagaagcgcggccgcgttctgggtctgtggatcgagcagctggtggccgag
agcctgggcaaggacggccagggcattctgcccaacatcgaggtggactccctgctgctc
aagaaagacccgggcgatcgcagcgccatcgtgtacctcacgcgcaacgacctgtgggac
gagcgccgcaacttcgagatgagcctgtcctacatcgacccggccatcccgcgcgccaac
tacaagatcgactccgtcgaagagctggccgagcacttcgtgatgtgggaatacgccatc
gcgatgtgcggctacctcatgaagatctgccccttcgaccagcccgacgtggcgtcggcg
aaggccgtggtgctcgacatcctcaaggagggccagcccgagcccgacttcgtgcaggat
ttcatcgacgaggtgcacatgggcgaggtggaagtgcgcctgtctccgtgcttcaaagat
tgcaccgatgtccgcagcgcgctgcgtgcgctgctgggcagcattcaaccgggcgatttc
ttcgcgctcaacgcgttcttgccgttcacgggcgagggtcgacgcgaggcgctggaaacc
atccgtcacggcgtggctgagaagcgcggcgtggtatcctgcctggaagtgggtccgcgc
tacctgcactccaccggccagctgcacaagggcggcccgaactgcggcgtgttcctcatc
ctgtcggccgacgagctaaaggacatcccgctgaagcaggaggctgaaagcctgggctcg
ctggccaaggcgcaggcgtcgggcgacctcgttacgctggccgagcgcgggcggcgcgtg
gtgcacctgcacctgcccgacaactcgggcgttacgctgcgccagctggctgaagtgatt
tccgacatcctggaaaccatgacggtgccgacggcttag

DBGET integrated database retrieval system