KEGG   Eggerthella lenta: Elen_0139Help
Entry
Elen_0139         CDS       T00984                                 

Definition
phosphoglucose isomerase
Orthology
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ele  Eggerthella lenta
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Elen_0139
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Elen_0139
   00030 Pentose phosphate pathway
    Elen_0139
   00500 Starch and sucrose metabolism
    Elen_0139
   00520 Amino sugar and nucleotide sugar metabolism
    Elen_0139
Enzymes [BR:ele01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Elen_0139
Exosome [BR:ele04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Elen_0139
  Exosomal proteins of other body fluids (saliva and urine)
   Elen_0139
  Exosomal proteins of colorectal cancer cells
   Elen_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
192154..193872
Genome map
AA seq 572 aa AA seqDB search
MLSGDVEKLYPSAKALVKDCVASRIHAKDASLYDFSEEARACSEQYMGWTDLASNSPYSL
RDIQNFADSIIAQGLKTVVLIGQGGSTQAPMTITKYNKPDSSKITFKTLDSDSPVRVRAI
LAEAKPETTLFVISSKSGGTIEPRLALRAVRDAVADRISEEELVQHLVAITDPGSMLERQ
AREEGWAAVFSGQPTVGGRFSALSVFGLLPAALVGIDLEEFMAHAIDAERQCSEDAIDNP
AIGLASFLYDNYLQGRNKFTFLTQKRGRVLGLWIEQLVAESLGKDGQGILPNIEVDSLLL
KKDPGDRSAIVYLTRNDLWDERRNFEMSLSYIDPAIPRANYKIDSVEELAEHFVMWEYAI
AMCGYLMKICPFDQPDVASAKAVVLDILKEGQPEPDFVQDFIDEVHMGEVEVRLSPCFKD
CTDVRSALRALLGSIQPGDFFALNAFLPFTGEGRREALETIRHGVAEKRGVVSCLEVGPR
YLHSTGQLHKGGPNCGVFLILSADELKDIPLKQEAESLGSLAKAQASGDLVTLAERGRRV
VHLHLPDNSGVTLRQLAEVISDILETMTVPTA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctatccggtgatgtagaaaaactgtatccttccgcgaaagccctcgtgaaggactgc
gttgccagccgtatccatgccaaggatgcgagcctgtacgacttctcggaggaagcgcgc
gcgtgctccgagcaatacatgggatggacggaccttgcgagcaattcgccgtactccctg
cgcgacatccagaatttcgccgactcgatcatcgcccaagggctgaagacggtcgtgctc
atcggccagggcggttccacgcaggcgcccatgaccatcacgaaatacaacaagcccgat
tcgtcgaagatcacgttcaagacgctggactccgactcgcccgtgcgcgtgcgcgccatt
ttggccgaagcgaagcccgagaccacgctgttcgtgatctcgtcgaagagcggcggcacc
atcgagccgcgcctggccctgcgtgccgtgcgcgacgccgtggccgaccgcatcagcgaa
gaggagctggtgcagcacctcgtggccatcaccgaccccggctccatgcttgagcgccag
gcgcgcgaagaagggtgggccgcggtgttctccggccagcccaccgtgggcgggcgcttc
tccgcgctgtccgtgttcggcctgctgccggcggcgctcgtgggcatcgacctggaagag
ttcatggcgcacgccatcgacgccgagcgccagtgcagcgaggacgccatcgacaacccg
gccatcggcctggcatcgtttttgtacgacaactacctgcagggacgcaacaagttcacg
ttcctcacgcagaagcgcggccgcgttctgggtctgtggatcgagcagctggtggccgag
agcctgggcaaggacggccagggcattctgcccaacatcgaggtggactccctgctgctc
aagaaagacccgggcgatcgcagcgccatcgtgtacctcacgcgcaacgacctgtgggac
gagcgccgcaacttcgagatgagcctgtcctacatcgacccggccatcccgcgcgccaac
tacaagatcgactccgtcgaagagctggccgagcacttcgtgatgtgggaatacgccatc
gcgatgtgcggctacctcatgaagatctgccccttcgaccagcccgacgtggcgtcggcg
aaggccgtggtgctcgacatcctcaaggagggccagcccgagcccgacttcgtgcaggat
ttcatcgacgaggtgcacatgggcgaggtggaagtgcgcctgtctccgtgcttcaaagat
tgcaccgatgtccgcagcgcgctgcgtgcgctgctgggcagcattcaaccgggcgatttc
ttcgcgctcaacgcgttcttgccgttcacgggcgagggtcgacgcgaggcgctggaaacc
atccgtcacggcgtggctgagaagcgcggcgtggtatcctgcctggaagtgggtccgcgc
tacctgcactccaccggccagctgcacaagggcggcccgaactgcggcgtgttcctcatc
ctgtcggccgacgagctaaaggacatcccgctgaagcaggaggctgaaagcctgggctcg
ctggccaaggcgcaggcgtcgggcgacctcgttacgctggccgagcgcgggcggcgcgtg
gtgcacctgcacctgcccgacaactcgggcgttacgctgcgccagctggctgaagtgatt
tccgacatcctggaaaccatgacggtgccgacggcttag

DBGET integrated database retrieval system