KEGG   Eggerthella lenta: Elen_0417Help
Entry
Elen_0417         CDS       T00984                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ele  Eggerthella lenta
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Elen_0417
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Elen_0417
   00020 Citrate cycle (TCA cycle)
    Elen_0417
   00620 Pyruvate metabolism
    Elen_0417
   00640 Propanoate metabolism
    Elen_0417
   00650 Butanoate metabolism
    Elen_0417
  Energy metabolism
   00680 Methane metabolism
    Elen_0417
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Elen_0417
Enzymes [BR:ele01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Elen_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
535740..536948
Genome map
AA seq 402 aa AA seqDB search
MKRFLSGDEAFAEGVRLARPQVISAYPITPQTVVVERLSEMVEDGSLAAEYVHVESEHSA
LSCAIGASATGARTFTATSSQGLLYMAECLTYAAGGRFPIVMMNANRATALPWNIYGDQR
DSLALLDHGWIQVYAEDNQEALDLALMAYAVAENPAVATPVMVNLDGFALTHTYETVDVP
EPAEADAFLPPYEPAGNRFDFEHPVNIGFSAGPEYNRYFKYWEHRDMLDAPAVVTQVEQR
FAEVFGRQYPGMIETLDCDDADVILVTLGSAAGLVRSVVRQLRDQGVRAGMLRIRYLRPM
PSALIAEALRGAKAVGVLEKDVSFGAEGTVFTNVNSALQQAAVGVPTYNFVGGLGGDDIS
EAQVHGMYRMLVQAAEGTGELPRVSFLGIDSPADALGAERGR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggttcctttccggcgacgaagcgttcgccgaaggcgtgcgcttggcgcgcccg
caggtgatttccgcgtatcccatcacaccgcagacggtggtggtggagcgactgagcgag
atggtcgaggacggctcgctggccgccgagtacgtgcacgttgaaagcgagcattcggcg
ctgtcgtgcgccatcggcgcgtcggctacgggtgcgcgcacgttcacggccacgtcgagc
cagggtttgctgtacatggccgagtgcctgacctacgcggcgggcggacggttccccatc
gtgatgatgaacgcgaaccgcgcaaccgcgctgccgtggaacatctacggcgaccagcgc
gactcgctggcgctgctcgaccatggatggatccaggtgtacgccgaagacaaccaggag
gcgctcgacctggcgctcatggcgtacgcggtggccgagaaccctgcggtggcaacgccc
gttatggtgaacctcgacgggttcgcgctcacgcacacctacgagacggttgacgtgccc
gaacccgccgaggccgacgcgttcctgccaccctacgagcctgcgggcaaccggttcgac
ttcgagcatcccgtgaacatcggcttctcggccggtcccgagtacaaccgctacttcaag
tactgggagcatcgcgacatgctggacgcgcccgctgtggtcacccaggtggagcagcgg
ttcgccgaggtgttcggtcggcagtatcccggcatgatcgagacgctggactgcgacgat
gccgatgtgatactggtcacgctgggatcggcggccgggctggtgcgctcggtggtgcgg
cagctgcgcgaccagggcgtgcgcgcgggcatgctgcgcatccgctacctgcgtcccatg
ccgagcgcgctcatcgccgaggcgctgcgcggcgcgaaggctgtgggagtgctggagaag
gacgtgtcgttcggcgccgagggcaccgtgttcacgaatgtgaactccgcgctgcagcaa
gcggccgtgggcgtgcccacgtacaacttcgtgggcggcttgggcggcgacgatatatcg
gaagcgcaagtgcatggcatgtaccgcatgctcgtacaggcggccgaggggacgggcgag
ctgccgcgcgtatcgttcctcgggatcgattctccggcggatgcgctcggtgcggaaagg
gggcggtag

DBGET integrated database retrieval system